Align fumarylacetoacetate (FAA) hydrolase (EC 3.7.1.2) (characterized)
to candidate WP_012757078.1 RLEG_RS07460 FAA hydrolase family protein
Query= reanno::psRCH2:GFF3447 (327 letters) >NCBI__GCF_000023185.1:WP_012757078.1 Length = 341 Score = 409 bits (1050), Expect = e-119 Identities = 212/336 (63%), Positives = 252/336 (75%), Gaps = 12/336 (3%) Query: 1 MKLATLNQG-RDGVLVVVSRDLAQAVKVPQIAATLQAALDDWNYCKPKLEAVYQRLNDGL 59 MKLATL RDG LVVVSRDL + +V IA TLQAALDDW + P+L + + + G Sbjct: 1 MKLATLKDSTRDGRLVVVSRDLTRCSEVGHIARTLQAALDDWEHVAPRLALIAEGVETGA 60 Query: 60 EEGAFAFDQTACHSPLPRAYHWADGSAYVNHVELVRKARGAEMPESFWHDPLMYQGGADA 119 + F + SPLPRAY WADGSAYVNHVELVRKARGAEMP SFW DPL+YQGG+DA Sbjct: 61 QP-TIRFHEHDATSPLPRAYQWADGSAYVNHVELVRKARGAEMPASFWTDPLIYQGGSDA 119 Query: 120 FIPPHSPIRLADEAWGIDLEGELAVITDDVPMGATPAEAASHIQLLMLVNDVSLRNLIPG 179 F+ P PI ADEA+GID+EGE+AV+T DV MG +P A I+LLMLVNDVSLR+LIPG Sbjct: 120 FLAPRDPIVAADEAYGIDMEGEVAVLTGDVDMGCSPEAARGAIRLLMLVNDVSLRSLIPG 179 Query: 180 ELAKGFGFYQSKPSSSFSPVAVTPDELGETWRDGKVHRPLVSHINGELFGQPDAGTDMTF 239 ELAKGFGF+QSKP+S+FSPVAVTPDELG+ W GK+H PL+ +NG+ FG+ +AG DMTF Sbjct: 180 ELAKGFGFFQSKPASAFSPVAVTPDELGDAWDGGKLHLPLLVSLNGKPFGKANAGIDMTF 239 Query: 240 NFPTLVAHAARTRPLGAGTIIGSGTVSN----------YDRSAGSSCLAEKRMLEVVEHG 289 +F L+AHAA+TR L AGTIIGSGTVSN + G SC+AE RM+E +E G Sbjct: 240 DFAQLIAHAAKTRNLAAGTIIGSGTVSNKLNGGPGKPVEEGGDGYSCIAEIRMIETIETG 299 Query: 290 EAKTPFLKFGDRVRIEMFDAAGQSIFGAIDQQVERY 325 KTPF+KFGD+VRIEM D AG SIFGAI+Q VE+Y Sbjct: 300 SPKTPFMKFGDQVRIEMKDKAGHSIFGAIEQTVEKY 335 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 341 Length adjustment: 28 Effective length of query: 299 Effective length of database: 313 Effective search space: 93587 Effective search space used: 93587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory