Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_012759080.1 RLEG_RS18580 short-chain dehydrogenase
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_000023185.1:WP_012759080.1 Length = 259 Score = 276 bits (705), Expect = 4e-79 Identities = 135/256 (52%), Positives = 177/256 (69%) Query: 16 GERLKNKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHAL 75 G RL+ K +L+TGAAQGIG A+ AF + A + + D A + A + G + L Sbjct: 2 GGRLQGKNILITGAAQGIGLAMAKAFMREDAAVFLVDRDAALLARAAKELQSSGGRLGYL 61 Query: 76 KADVSNQQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWY 135 AD+++ + + A E G+++ LVN AGVNVF +PLE T+E+W RCF I+L GAW Sbjct: 62 PADITDAGTITTLVAQANEEIGQLNALVNNAGVNVFAEPLETTDEEWNRCFDINLKGAWN 121 Query: 136 GCKAVLPQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRV 195 CKAVLP +IEQG G I+NIASTH+ IIP FPYP+AKH LLG+T++LG+EYA + +RV Sbjct: 122 CCKAVLPGLIEQGGGVILNIASTHAFTIIPHTFPYPLAKHALLGMTKSLGLEYAARNIRV 181 Query: 196 NAIAPGYIETQLNVDYWNGFADPYAERQRALDLHPPRRIGQPIEVAMTAVFLASDEAPFI 255 NA+APGY+ TQ +DYWNGF DP A + + LHP RI P E+AM AVF+ SDE PFI Sbjct: 182 NALAPGYVSTQKVIDYWNGFPDPEAAKAETMKLHPGGRIATPEEIAMAAVFMISDECPFI 241 Query: 256 NASCITIDGGRSVMYH 271 NA+C+TIDGG SV+ H Sbjct: 242 NATCLTIDGGLSVLQH 257 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 259 Length adjustment: 25 Effective length of query: 247 Effective length of database: 234 Effective search space: 57798 Effective search space used: 57798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory