Align ABC transporter for Lactose, permease component 1 (characterized)
to candidate WP_012760014.1 RLEG_RS33205 sugar ABC transporter permease
Query= reanno::Smeli:SM_b21653 (298 letters) >NCBI__GCF_000023185.1:WP_012760014.1 Length = 286 Score = 222 bits (565), Expect = 9e-63 Identities = 121/282 (42%), Positives = 172/282 (60%), Gaps = 5/282 (1%) Query: 15 NGWLFVAPALGLITLFMVYPIAWSLWMSFQSGRGMTLKFAGFANIVRLWNDPVFIKALTN 74 + + F+AP L + F V+PI S +SFQ+ R KF+ AN RL+ DP F AL N Sbjct: 7 SAYAFLAPYLLVFATFWVWPIINSFLISFQNTRINPWKFSFQANWGRLFYDPAFYNALYN 66 Query: 75 TMTYFVVQVPIMILLALILASLLNNPRLVGRGVFRTAIFLPCVSSLVAYSVLFKGMFATD 134 T+ V+QVP+MI LA ++A +LN+P L R +FR A F P V VAY+ +F+ MF+ D Sbjct: 67 TLIILVIQVPVMIALATVMAVMLNSPLLKARPLFRFAFFAPVVVGEVAYAAVFRLMFSLD 126 Query: 135 -GIVNSTLQAIGLAASPIPWLTHPFWAKVLVILAITWRWTGYNMIFYLAALQNIDKSIYE 193 GI+N + A+GL SP+ W + A L+ILA+TWRW GYN I LA LQ+I +YE Sbjct: 127 FGIINKLISAVGL--SPVSWFDNANAAMALIILAVTWRWAGYNAIIILAGLQSIPDDVYE 184 Query: 194 VARIDGVPAWARLTHLTIPLLKPVILFTTVISTIGTLQLFDEVYNLTEGKGGPSNATLTL 253 A +D V + H+T+PLLKP+ILF V+S IGT+QLF E + +T +GGP T TL Sbjct: 185 AATLDRVSKIQQFFHITLPLLKPIILFCVVLSVIGTMQLFTEPFLIT-NRGGPGGGTETL 243 Query: 254 SLYIYNLTFRFMPNLGYAATVSYVIVVLVALLAFVQFFAARE 295 L +Y F + N GYA+ ++Y + L ++ + + R+ Sbjct: 244 GLLLYRQGFTSL-NFGYASAIAYTMAALAVAISLLNLWVGRD 284 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 286 Length adjustment: 26 Effective length of query: 272 Effective length of database: 260 Effective search space: 70720 Effective search space used: 70720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory