Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_012760277.1 RLEG_RS30500 DUF2437 domain-containing protein
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000023185.1:WP_012760277.1 Length = 282 Score = 126 bits (316), Expect = 7e-34 Identities = 88/242 (36%), Positives = 128/242 (52%), Gaps = 17/242 (7%) Query: 52 SSPASTSSPRVLTVQTLLSPLAPTDVPA-IRGMGLQYSG---DPANPQDKPPVACLFF-K 106 S+ S S+P L + L LAP D P +G+ Y + A P + L+F K Sbjct: 48 SAIQSVSAPCFLLSEVRL--LAPIDDPRKFLAIGMNYKAHAEEAAAAGIATPKSQLWFNK 105 Query: 107 ASQALAGPGDDIVLPRLARDEKNDYEVELCVVLGKDAKDVDEKDAMSFVGGYCVVNDVSS 166 + GP DDIV+P ++ EK DYE EL V+G + V +DA S + GY V NDV++ Sbjct: 106 QVSCINGPFDDIVIPEVS--EKVDYEAELGFVIGTRCRHVSREDARSVIAGYFVANDVTA 163 Query: 167 RGLCAKGGQWGMGKSYDTWCPFGPCLVSPSALGADPHKLTITTHVNGKLAQKGNTADLVL 226 R + + +GKS+DT P GP + + + ADPH LT+T +NG+ Q+ +T D++ Sbjct: 164 RDWQFRSPTYTLGKSFDTHGPIGPWITTADEV-ADPHDLTLTLSLNGEERQRTSTGDMIY 222 Query: 227 KIPELIARLSHGTTLQAGSLILTGSPIALGRKAPGDAVEQSPFMKDGDEIRCFVEGCGTL 286 I + IA LS TL+ G +I TG+P +G + FMK GD +R V G G + Sbjct: 223 NIWDQIAYLSTVMTLEPGDIIATGTPSNVG-------IATETFMKAGDVVRVEVSGLGVI 275 Query: 287 IN 288 N Sbjct: 276 EN 277 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 282 Length adjustment: 26 Effective length of query: 282 Effective length of database: 256 Effective search space: 72192 Effective search space used: 72192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory