Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_012760743.1 RLEG_RS35145 3-hydroxyacyl-CoA dehydrogenase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_000023185.1:WP_012760743.1 Length = 255 Score = 326 bits (836), Expect = 3e-94 Identities = 165/255 (64%), Positives = 199/255 (78%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADI 60 M I FIV+G SGLGAAT + LVEAG +V + DLNA+A + ARE G +A F AD+ Sbjct: 1 MLIRGASFIVTGGGSGLGAATVRALVEAGGRVTIADLNAEAGQEIAREFGSDACFVKADV 60 Query: 61 SDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFN 120 +D + + V AAV AFGSL GLVNCAG+ AEKV+G+ GPH L SFA+ + +NLIG+FN Sbjct: 61 TDGEEGAAVVAAAVEAFGSLRGLVNCAGVAPAEKVIGRDGPHRLESFARTVGINLIGTFN 120 Query: 121 LLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELA 180 ++RLAAAA+ D GERGVI+NTAS+AA+DGQIGQAAYAASKG +A++TLP ARELA Sbjct: 121 MIRLAAAAIQTTEPDAEGERGVIVNTASVAAFDGQIGQAAYAASKGGVAAMTLPIARELA 180 Query: 181 RFGIRVMTIAPGIFETPMMAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIENSMLN 240 R GIRV+ IAPGIFETPMMA M EV+A+L VPFPPRLGRP E+A L RHI+EN+MLN Sbjct: 181 RHGIRVVAIAPGIFETPMMADMPAEVQAALGKSVPFPPRLGRPAEFAGLVRHILENNMLN 240 Query: 241 GEVIRLDGALRMAAK 255 GEVIRLDGALRM A+ Sbjct: 241 GEVIRLDGALRMGAR 255 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory