Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012851135.1 TCUR_RS03710 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000024385.1:WP_012851135.1 Length = 268 Score = 216 bits (549), Expect = 5e-61 Identities = 110/251 (43%), Positives = 161/251 (64%), Gaps = 1/251 (0%) Query: 10 LKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFELA 69 L+V ++ RF GL AL V T++ G ++ LIGPNGAGK+T FNV++G+Y G+ + Sbjct: 7 LQVRDVTVRFSGLVALDSVSFTVRPGSIHALIGPNGAGKSTCFNVLSGVYKATFGSVKFG 66 Query: 70 GKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFKA 129 G H++A G+ARTFQNI L ++ +N+M+GRH T +G A R + Sbjct: 67 GTELTGLPPHKIAALGVARTFQNIALSPLLSVADNLMLGRHRLTRTGFLSAGLRLPRARR 126 Query: 130 EEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGMN 189 E AA + R E+ +VG+ ++ L YG Q+R+E+ARAL +P+L+ LDEP AGMN Sbjct: 127 EAAAHSARVAEIAAFVGLSEYLPMPVGLLPYGVQKRVELARALCMEPKLLLLDEPVAGMN 186 Query: 190 ATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 E+ ++ LI +R D ++LL+EHD+ +VM L D VTVLD+G++IA+G PAEVQ++ Sbjct: 187 GGERRKMAALISAVRRDLGISVLLVEHDMGMVMRLADAVTVLDFGRRIADGTPAEVQRDP 246 Query: 249 KVIEAYLGTGG 259 +VI AYLG G Sbjct: 247 EVIRAYLGAAG 257 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 268 Length adjustment: 25 Effective length of query: 235 Effective length of database: 243 Effective search space: 57105 Effective search space used: 57105 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory