Align Beta-ketothiolase BktB; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_012852217.1 TCUR_RS09190 acetyl-CoA C-acyltransferase
Query= SwissProt::Q0KBP1 (394 letters) >NCBI__GCF_000024385.1:WP_012852217.1 Length = 402 Score = 339 bits (870), Expect = 7e-98 Identities = 195/402 (48%), Positives = 246/402 (61%), Gaps = 13/402 (3%) Query: 3 REVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQTEP 62 REVV+ S VRT +G FGG+L+DV P L A V+ E L R D + V+ G Sbjct: 2 REVVICSPVRTPVGRFGGALRDVPPQRLAATVIAELLKRT--GADRIDEVILGQCYPNGE 59 Query: 63 RDMYLGRVAAVNGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESMSR 122 +GRVAA++ G+ + P ++R CGSGLQA+++A + G I GG ESMS+ Sbjct: 60 APA-IGRVAALDAGLPVEVPGSQIDRRCGSGLQAVINAVLMVQSGACQTVIAGGVESMSQ 118 Query: 123 APYLAPAARWGARMGDAGLVDMMLGALHDPFHRIH-----MGVTAENVAKEYDISRAQQD 177 Y A RWG + L+D + A P H M TAENV +Y I RA+QD Sbjct: 119 VEYYATGLRWGRPGAEIKLMDRLDRARVTPGGEHHPVPGGMLETAENVRAKYGIPRAEQD 178 Query: 178 EAALESHRRASAAIKAGYFKDQIVPVVSKGRKGDVTFDTDEHVRHDATIDDMTKLRPV-- 235 E AL SH+RA AA + G F +IVPV GRK V D DEH R D T++ + LRPV Sbjct: 179 ELALRSHQRAVAAQREGRFDAEIVPVEVPGRKETVVVDRDEHPRADTTLEKLAALRPVRA 238 Query: 236 FVKENGTVTAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKAMGIGPV 295 V TVTAGNASG ND AA ++ R EA+R GL ARLVS+ AGV P+ MG+GPV Sbjct: 239 AVDPGATVTAGNASGQNDGAAVCLVTTRQEADRLGLTVRARLVSWAVAGVPPELMGLGPV 298 Query: 296 PATKIALERAGLQVSDLDVIEANEAFAAQACAVTKALGL---DPAKVNPNGSGISLGHPI 352 PAT ALE+AGL ++D+D+IE NEAFAAQ VT+ G D ++N NGSGISLGHP+ Sbjct: 299 PATARALEQAGLTLADMDLIELNEAFAAQVLGVTREWGFGAGDFERLNVNGSGISLGHPV 358 Query: 353 GATGALITVKALHELNRVQGRYALVTMCIGGGQGIAAIFERI 394 GATG I ++E+ R Q RY L TMCIGGGQG+AA+FER+ Sbjct: 359 GATGCRILATLMYEMERRQARYGLETMCIGGGQGLAAVFERV 400 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 402 Length adjustment: 31 Effective length of query: 363 Effective length of database: 371 Effective search space: 134673 Effective search space used: 134673 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory