Align propionate-CoA ligase (EC 6.2.1.17) (characterized)
to candidate WP_012852611.1 TCUR_RS11195 AMP-dependent synthetase and ligase
Query= BRENDA::A0A0G2K047 (683 letters) >NCBI__GCF_000024385.1:WP_012852611.1 Length = 479 Score = 321 bits (823), Expect = 4e-92 Identities = 184/484 (38%), Positives = 265/484 (54%), Gaps = 25/484 (5%) Query: 65 SVADPERFWGKAAEQISWYKPWTKTLENRYPPSTSWFVEGMLNICYNAIDRHIENGQGDK 124 S+ DP RFWG AA ++ W P + L++ PP WF G LN+C NA+DRH+ G GD+ Sbjct: 11 SITDPARFWGMAAREVHWLVPPDRVLDDGAPPFYRWFTGGELNVCDNALDRHVAAGHGDR 70 Query: 125 IAIIYDSPVTDTKATISYKEVLEQVSKLAGVLVKQGVKKGDTVVIYMPMIPQAIYAMLAC 184 A+IY ++ E+ E V++ AG L + GV GD V++++P+ P A+ A+LAC Sbjct: 71 PALIYPGGAAGPPQVRTFGELAETVARFAGALAELGVGGGDRVLVHLPLSPDAVVAVLAC 130 Query: 185 ARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRKVEYMPLLEEALRIGQHK 244 AR+GA+H + + EL+ +ID +PK VV A+ G P+LE ALR+ H+ Sbjct: 131 ARLGAVHVVPSQRAGAGELAAQIDLTRPKAVVAAA-----GEDGTAKPVLESALRLASHR 185 Query: 245 PDRLLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKG 304 R LI +RP+ VP RD+ WEE +A A+ C P + PL+IL+ G G+ +G Sbjct: 186 IPRRLIRHRPDARVVP---PRDVTWEEALAAARPAGCAPAAATDPLHILFAPGPEGVVRG 242 Query: 305 VVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGK 364 VVR GGYAV L WTM IYG PGEV+ A DLGW G S + PLL G T +L++G Sbjct: 243 VVRDHGGYAVALRWTMEHIYGAGPGEVFGATCDLGWAAGLSGALHAPLLTGCTLLLHDG- 301 Query: 365 PVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERC 424 ++ AEHG A+ T A+R G A + + +F+AG R Sbjct: 302 ------GAGFWAAAAEHGAKAVLTTAATAGALRA--AGGAPDRAPA-----AVFLAGRRP 348 Query: 425 DVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTP-PPGQAGKCVPGYNVMIL 483 D + + PV W + ETG PI A+ GL TP P AG VPG++V +L Sbjct: 349 DRRICARASRALCRPVTWQWERPETGRPIAAAPHGL--EPTPVDPEAAGPPVPGFDVHVL 406 Query: 484 DDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEG 543 + A + G + ++LPLPPG+ + LW++ E F + + PGY+ T DAG + +G Sbjct: 407 APDGAPAAAGTDGELAIRLPLPPGSLTTLWRDDERFVAEHLARRPGYFLTGDAGRLGADG 466 Query: 544 YLYV 547 ++ V Sbjct: 467 HVRV 470 Lambda K H 0.318 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1034 Number of extensions: 69 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 683 Length of database: 479 Length adjustment: 36 Effective length of query: 647 Effective length of database: 443 Effective search space: 286621 Effective search space used: 286621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory