Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012853185.1 TCUR_RS14085 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000024385.1:WP_012853185.1 Length = 276 Score = 268 bits (685), Expect = 9e-77 Identities = 136/248 (54%), Positives = 177/248 (71%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 VL++ ++ RFGG+ A++ + +T++ G+++ LIGPNGAGKTT FNVITG+Y P G L Sbjct: 23 VLQMQSVTMRFGGVVAINGLDLTVREGEIFALIGPNGAGKTTVFNVITGVYRPTEGQVLL 82 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 G+ + K G+ARTFQNIRLF MT LENV+VG +G GA + Sbjct: 83 RGERINGRKRFAITKRGVARTFQNIRLFHNMTVLENVLVGADAHHKTGFMGAALGLPWHR 142 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 EE +A+ELL++VG+ D A+ L YGDQRRLEIARALATDP+L+ LDEPAAGM Sbjct: 143 REEREGRAKARELLEFVGVAHRMDEPAKNLPYGDQRRLEIARALATDPRLLLLDEPAAGM 202 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 N EKV+L+ELI RIR+ RT+LLIEHD+ LVMG+ DRV VLD+G++IAEG P +VQ++ Sbjct: 203 NPAEKVRLQELIGRIRDSGRTVLLIEHDMSLVMGISDRVAVLDFGQKIAEGLPQDVQRDP 262 Query: 249 KVIEAYLG 256 KVIEAYLG Sbjct: 263 KVIEAYLG 270 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 276 Length adjustment: 25 Effective length of query: 235 Effective length of database: 251 Effective search space: 58985 Effective search space used: 58985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory