Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012853488.1 TCUR_RS15580 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000024385.1:WP_012853488.1 Length = 292 Score = 207 bits (526), Expect = 3e-58 Identities = 107/248 (43%), Positives = 157/248 (63%), Gaps = 1/248 (0%) Query: 10 LKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFELA 69 LKV ++ +F G+ AL VG T++ G ++ +IGPNGAGK+T FNV++G+Y +G+ Sbjct: 4 LKVTDLTVKFAGITALDHVGFTVEPGSIHAIIGPNGAGKSTCFNVLSGVYKATSGSVRFG 63 Query: 70 GKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFKA 129 G H++A G+ARTFQNI L + +NVM+GRH +G + Sbjct: 64 GAELTRMPPHKIAALGVARTFQNIALSRFQSVEDNVMLGRHRLMRAGFLSTGLHLPHARR 123 Query: 130 EEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGMN 189 E+A R +E+ +VG+ ++ D L YG Q+R+E+ARALA +P+L+ LDEP AGMN Sbjct: 124 EDARHRARVREIARFVGVAEYLDAPVGMLPYGVQKRVELARALAMEPKLLLLDEPVAGMN 183 Query: 190 ATEKVQLRELIDRIRND-NRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 E+ + E+I R D +ILL+EHD+ +VM L D+VTVLD+G++IA G PA+VQ + Sbjct: 184 GGERRAMAEVIVAARADLGISILLVEHDMGMVMRLADQVTVLDFGRKIASGPPAQVQNDP 243 Query: 249 KVIEAYLG 256 +VI AYLG Sbjct: 244 EVIRAYLG 251 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 292 Length adjustment: 25 Effective length of query: 235 Effective length of database: 267 Effective search space: 62745 Effective search space used: 62745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory