Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_012853810.1 TCUR_RS17185 ABC transporter ATP-binding protein
Query= TCDB::P0A9S7 (255 letters) >NCBI__GCF_000024385.1:WP_012853810.1 Length = 244 Score = 181 bits (459), Expect = 1e-50 Identities = 100/250 (40%), Positives = 151/250 (60%), Gaps = 12/250 (4%) Query: 4 PLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTIL 63 PLL G+ +RFGG AVN+V+L + +I LIGPNGAGKTT+FN +TG KPT G +L Sbjct: 2 PLLETRGITVRFGGNTAVNDVSLTVEEGQITGLIGPNGAGKTTLFNTITGLQKPTSGRVL 61 Query: 64 LRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPSF 123 L + L + AR G+ RTFQ + LF ++V +N+ VA TG Sbjct: 62 LDGADITRLSPAKRARRGMARTFQRLELFLSLSVRDNVRVAGDVLKVTG----------- 110 Query: 124 RRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAAG 183 RR + + + LER GL + A++ S++ G R +E+AR ++T P +L+LDEPA+G Sbjct: 111 RRRRFDLDEETDRVLERTGLTDIAHKDVSDVPIGRARVVEVARALMTSPRVLLLDEPASG 170 Query: 184 LNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIRN 243 +ET+ EL+ L I L+EHD+ LVM + I+V++ G+ +A+GTP++++ Sbjct: 171 QTERETEAFAELLVGLA-AEGLAICLVEHDLPLVMRLCSTIHVLDYGSLIASGTPQEVKE 229 Query: 244 NPDVIRAYLG 253 +P+VI AY+G Sbjct: 230 SPEVIAAYIG 239 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 244 Length adjustment: 24 Effective length of query: 231 Effective length of database: 220 Effective search space: 50820 Effective search space used: 50820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory