Align hexokinase (EC 2.7.1.1) (characterized)
to candidate WP_012854336.1 TCUR_RS19775 ATPase
Query= BRENDA::Q96Y14 (299 letters) >NCBI__GCF_000024385.1:WP_012854336.1 Length = 382 Score = 72.0 bits (175), Expect = 2e-17 Identities = 55/184 (29%), Positives = 85/184 (46%), Gaps = 14/184 (7%) Query: 4 IVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVG----------LTRAIENIKEAVK 53 ++GVDAGGTKT+ G G G+ GPG N G L+ A+ ++ ++ Sbjct: 1 MIGVDAGGTKTRVAVLTLGGALAGSGT-GPGANPNSGGDTVGALTTALSAALGDLDRSLV 59 Query: 54 IAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVI 113 + G + G G AG + A ++ + D +A A T G+VV Sbjct: 60 L--NGVFGIAGAGSAGRPAAVAAAQRAWHAVGLSGSPAVVTDIAVAFAAGTDASEGIVVF 117 Query: 114 AGTGSVVEGYN-GKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKV 172 +GTG+ + G R G G+L+ D GSA W+GR+A+R L +DG T+L V Sbjct: 118 SGTGAGAAVISDGTIVRRADGYGYLVGDQGSAVWLGREAVRATLSALDGRGEPTLLAESV 177 Query: 173 LKTI 176 + + Sbjct: 178 PRAL 181 Lambda K H 0.317 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 382 Length adjustment: 28 Effective length of query: 271 Effective length of database: 354 Effective search space: 95934 Effective search space used: 95934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory