Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate WP_012964640.1 FERP_RS00515 phosphoglucosamine mutase
Query= metacyc::MONOMER-13382 (455 letters) >NCBI__GCF_000025505.1:WP_012964640.1 Length = 445 Score = 427 bits (1099), Expect = e-124 Identities = 214/452 (47%), Positives = 304/452 (67%), Gaps = 11/452 (2%) Query: 3 KLFGTFGVRGIANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALI 62 +LFGT GVRGIANE++T E A+ +G T+ + GR + + DTR+S EMLK A+I Sbjct: 4 ELFGTNGVRGIANEELTAEMALNLGRTIATM--KPGR----IAIACDTRISSEMLKSAVI 57 Query: 63 SGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKK 122 +G+LS G D +D+G+APTPA+Q+ K N D G ++TASHNP EYNGIK ++ +G Sbjct: 58 AGILSAGSDAVDLGVAPTPALQYYVKENNVDAGVIVTASHNPREYNGIKYIQEDGTEFTW 117 Query: 123 EREAIVEELFFKEDFDRAKWYEIGEVRREDIIKPYIEAIKSKVDVEAIKKRKPFVVVDTS 182 E + E+++ + F +A+W E+G + R+D I Y+ I KVD E I++RK VV+D Sbjct: 118 EMDEEAEKIYKSKSFRKARWNEVGRILRDDCIDLYVSGILEKVDAEEIERRKFRVVLDCG 177 Query: 183 NGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGADFGVAQ 242 NGA S T P +L+ L C+V+T+N PDG F ARNPEP +E+L E VKA ADFGVA Sbjct: 178 NGAASFTSPEILKRLNCEVLTLNCNPDGRFTARNPEPVDEHLDMLKEAVKAFKADFGVAH 237 Query: 243 DGDADRAVFIDENGRFIQGDKTFALVADAVLKEKGGGLLVTTVATSNLLDDIAKKHGAKV 302 DGDADRA F+DE G F+ D T A++A +++ GGG++VT V++S ++D+ ++ G +V Sbjct: 238 DGDADRATFVDEKGNFVSEDVTLAIMAKYYVEQHGGGVVVTPVSSSRCVEDVVREAGGEV 297 Query: 303 MRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKSGKKFSE 362 + T VG +VA+ + E N GGE NGG+IFPEH+L RDG M++AK +E+ A +GKK SE Sbjct: 298 VYTAVGSPVVAKVMKEKNAVFGGEGNGGLIFPEHLLARDGGMSLAKFMELMALTGKKLSE 357 Query: 363 LIDELPKYYQIKTKRHVEGDRHAIVNKVAEMARERGYTVDTTDGAKIIFEDGWVLVRASG 422 L +E+PKY+ IK K DR ++ E R + TDGA+I +EDGW+L+R SG Sbjct: 358 LAEEIPKYHMIKLKVECR-DR----KRLLEGLRREFPEANFTDGARIDYEDGWLLIRPSG 412 Query: 423 TEPIIRIFSEAKSKEKAQEYLNLGIELLEKAL 454 TEPI RIF+EAK++ KA+E G+ +++K L Sbjct: 413 TEPIARIFAEAKTESKAKELAEFGVSVVKKIL 444 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 445 Length adjustment: 33 Effective length of query: 422 Effective length of database: 412 Effective search space: 173864 Effective search space used: 173864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory