Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_012966166.1 FERP_RS08410 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000025505.1:WP_012966166.1 Length = 242 Score = 183 bits (464), Expect = 3e-51 Identities = 104/251 (41%), Positives = 154/251 (61%), Gaps = 16/251 (6%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 LL V+ L K FGG+ AV VT E+ EGE +G++GPNG+GKTTL+NL++G+Y P EG V Sbjct: 2 LLRVENLRKSFGGIKAVDGVTFEIEEGEAIGIVGPNGSGKTTLYNLISGIYLPDEGKVIF 61 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLI-AFGNHHKQHVFTSFLRLPAF 121 +G + PY+ A LG+ RTFQ R F + TVL+NV I A K V AF Sbjct: 62 EGRDITNLPPYERAKLGIARTFQIPRPFGNATVLENVAIGAMFGREKLSV------EEAF 115 Query: 122 YKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAG 181 ++E+ LK +E LK AK L+ ++R +E+ RALA +PK+L LDE AG Sbjct: 116 ERAEEYLKLVGIEKLK--------HKEAKLLTPLEKRLMELARALAMKPKLLLLDEVMAG 167 Query: 182 MNPQETAELTELIRRIKDEFKITIM-LIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIK 240 MNP + + EL+++I E I I+ ++EH M +++ ER+ V+ G+++ +G P+++ Sbjct: 168 MNPVDVDRIIELLKKIHREEDIAIVSMVEHLMQAIVKFAERVIVMHQGKILVEGEPEKVL 227 Query: 241 TNKRVIEAYLG 251 + +VIE YLG Sbjct: 228 NHPKVIEVYLG 238 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 242 Length adjustment: 24 Effective length of query: 230 Effective length of database: 218 Effective search space: 50140 Effective search space used: 50140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory