Align L-lactate dehydrogenase; L-LDH; EC 1.1.1.27 (characterized)
to candidate WP_012966477.1 FERP_RS10055 malate dehydrogenase
Query= SwissProt::P16115 (319 letters) >NCBI__GCF_000025505.1:WP_012966477.1 Length = 295 Score = 218 bits (555), Expect = 1e-61 Identities = 125/311 (40%), Positives = 188/311 (60%), Gaps = 22/311 (7%) Query: 1 MKIGIVGLGRVGSSTAFALLMKGFAREMVLIDVDKKRAEGDALDLIHGTPFTRRANIYAG 60 MKIG VG GRVGS+ AF ++ E+ L+D+ + A G+A+DL H + G Sbjct: 1 MKIGFVGAGRVGSTAAFTCILYMDVDEVALVDIAEDLAVGEAMDLSHAAAAVDKYPKIVG 60 Query: 61 --DYADLKGSDVVIVAAGVPQKPGETRLQLLGRNARVMKEIARNVSKYAPDSIVIVVTNP 118 DY+ LKGSDV++V+AG+ +KPG +RL L +NA ++K+IA+ + + +P+S +IVVTNP Sbjct: 61 GSDYSLLKGSDVIVVSAGMARKPGMSRLDLATKNAGIIKDIAKKIMESSPESKIIVVTNP 120 Query: 119 VDVLTYFFLKESGMDPRKVFGSGTVLDTARLRTLIAQHCGFSPRSVH-VYVIGEHGDSEV 177 +D++TY KE+G +VFG G +LD+ARL+ + F R++ ++IGEHGDS Sbjct: 121 MDLMTYVMWKETGKPRNEVFGMGNMLDSARLKERLH---SFGARNIRKAWIIGEHGDSMF 177 Query: 178 PVWSGA-MIGGIPLQNMCQICQKCDSKILENFAEKTKRAAYEIIERKGATHYAIALAVAD 236 WS A G +P E E+ + A E+I+RKGAT Y A+++ Sbjct: 178 IPWSLADFDGDVP---------------REKILEEVRFVAAEVIKRKGATVYGPAVSIYR 222 Query: 237 IVESIFFDEKRVLTLSVYLEDYLGVKDLCISVPVTLGKHGVERILELNLNEEELEAFRKS 296 +V ++ D K + SV L+ G+ D+ + VP LGK+GVE+I+E L EEELEA + S Sbjct: 223 MVNAVVNDTKEEIPTSVVLQGEYGISDVAVGVPAILGKNGVEKIVEYELTEEELEALKNS 282 Query: 297 ASILKNAINEI 307 A+ILK + E+ Sbjct: 283 ANILKERLKEL 293 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 295 Length adjustment: 27 Effective length of query: 292 Effective length of database: 268 Effective search space: 78256 Effective search space used: 78256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory