Align 3-hydroxyadipyl-CoA dehydrogenase; EC 1.1.1.- (characterized)
to candidate WP_012967978.1 KVAR_RS11060 3-hydroxybutyryl-CoA dehydrogenase
Query= SwissProt::P76083 (475 letters) >NCBI__GCF_000025465.1:WP_012967978.1 Length = 307 Score = 134 bits (337), Expect = 4e-36 Identities = 96/291 (32%), Positives = 144/291 (49%), Gaps = 14/291 (4%) Query: 8 VAVIGSGTMGAGIAEVAASHGHQVLLYDISAEALTRAIDGIHARLNSRVTRGKLTAETCE 67 +AV+G+G MG GIA A HGH V LYD + L A L G+ + Sbjct: 6 LAVLGAGLMGVGIACHFARHGHVVRLYDTDPQRLAEVPAVASAILRELEASGQQDPADRD 65 Query: 68 RTLKRLIPVTDIHALAAADLVIEAASERLEVKKALFAQLAEVCPPQTLLTTNTSSISITA 127 L RL P ++ALA A L+IEA ERL +K AL+A+L + + ++ +NTS + + Sbjct: 66 AVLARLTPTPALNALADATLLIEAIPERLALKHALYAELETLIADEAIIASNTSGLPPDS 125 Query: 128 IAAEIKNPERVAGLHFFNPAPVMKLVEVVSGLATAAEVVEQLCELTLSWGKQPVRCH-ST 186 +A +++PER+ HF++P ++ LVEVV G AT + Q+ + + + V + + Sbjct: 126 LAQGMRHPERLLIAHFWHPPHLIPLVEVVPGSATLPHLARQVSDFCAACALEAVVLNRAA 185 Query: 187 PGFIVNRVARPYYSEAWRALEEQVAAPEVIDAALRDGAG---FPMGPLELTDLIG----Q 239 PGF+ NR+ EA + +A+ EV+D +R G +GPLE D+ G Q Sbjct: 186 PGFVGNRLQFALLREALHIVHSGIASAEVVDQVMRASLGRRYAMVGPLEAADMTGLATVQ 245 Query: 240 DVNFAVTCSVFNAFWQERRFLPSLVQQELVIGGRLGKKSGLGVYDWRAERE 290 D+ C + SLV E V G G +SG G Y W R+ Sbjct: 246 DI-----CQHLLPELASGSEMMSLV-AEKVARGDTGARSGQGFYRWDEARQ 290 Score = 28.5 bits (62), Expect = 3e-04 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Query: 386 PGMLIWRTVAMIINEALDALQKGVASEQDIDTAMRLGVNYPY---GPLAWGAQLGWQRIL 442 PG + R ++ EAL + G+AS + +D MR + Y GPL G + Sbjct: 186 PGFVGNRLQFALLREALHIVHSGIASAEVVDQVMRASLGRRYAMVGPLEAADMTGLATVQ 245 Query: 443 RLLENL 448 + ++L Sbjct: 246 DICQHL 251 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 475 Length of database: 307 Length adjustment: 30 Effective length of query: 445 Effective length of database: 277 Effective search space: 123265 Effective search space used: 123265 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory