Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_012968564.1 KVAR_RS16155 triose-phosphate isomerase
Query= BRENDA::Q7X216 (265 letters) >NCBI__GCF_000025465.1:WP_012968564.1 Length = 264 Score = 520 bits (1338), Expect = e-152 Identities = 255/264 (96%), Positives = 257/264 (97%) Query: 2 MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPSFTAIQPVSHFLQTHQ 61 MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIP FTAIQPVSHFLQ HQ Sbjct: 1 MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPPFTAIQPVSHFLQMHQ 60 Query: 62 LPLLTGAQNMHEADQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA 121 LPLLTGAQNMHEA QGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA Sbjct: 61 LPLLTGAQNMHEAGQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA 120 Query: 122 LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSHQQALRTLIAYEPVWAIGEHG 181 LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSHQQAL+ LIAYEPVWAIGEHG Sbjct: 121 LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLSHQQALQILIAYEPVWAIGEHG 180 Query: 182 TPASPQEAGVIHQALRQALCERFGHETGTRIPLLYGGXVTLQNAVELLRQQEINGLFIGR 241 TPASPQEAGVIHQALR+ALCERFGHETG RIPLLYGG VTLQNAVELLRQ EINGLFIGR Sbjct: 181 TPASPQEAGVIHQALREALCERFGHETGIRIPLLYGGSVTLQNAVELLRQPEINGLFIGR 240 Query: 242 AAWDAQGYCDIVQRVTQEFILQAQ 265 AAWDAQGYCDIVQRVTQEFILQAQ Sbjct: 241 AAWDAQGYCDIVQRVTQEFILQAQ 264 Lambda K H 0.321 0.133 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 264 Length adjustment: 25 Effective length of query: 240 Effective length of database: 239 Effective search space: 57360 Effective search space used: 57360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_012968564.1 KVAR_RS16155 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.29469.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-42 132.0 0.0 1.7e-42 131.8 0.0 1.0 1 lcl|NCBI__GCF_000025465.1:WP_012968564.1 KVAR_RS16155 triose-phosphate is Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025465.1:WP_012968564.1 KVAR_RS16155 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 131.8 0.0 1.7e-42 1.7e-42 4 224 .. 8 242 .. 5 246 .. 0.90 Alignments for each domain: == domain 1 score: 131.8 bits; conditional E-value: 1.7e-42 TIGR00419 4 infKlnesvgkvelevaklaeevaseagveva..vappfvdldvvkdeve.seiqv..aAqnvdavksG 67 +K+n +++ +la+ + + + ++ v ppf ++ v++ ++ ++++ +Aqn++ +G lcl|NCBI__GCF_000025465.1:WP_012968564.1 8 TSWKMNKPLSQAMAWCETLAARMPEGCHPAIQpfVIPPFTAIQPVSHFLQmHQLPLltGAQNMHEAGQG 76 579*******************99998766644499***********999656665337********** PP TIGR00419 68 aftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartin 136 a+tGeisA+ml+++Ga v +gHsErR+ ++e+d i+ kv + gl++++C+g++ ee+ + + lcl|NCBI__GCF_000025465.1:WP_012968564.1 77 AWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSALGHGLRPLICIGDSAEEKRWQVSRE 145 **************************************************************9999999 PP TIGR00419 137 nvattaaaaA.......lepdvvAvEPveliG.tGkpvskAeaevveksvrdhlkk.vskevaesvrvl 196 v ++ ++a + ++A+EPv++iG G p+s+ ea v+++ +r+ l + +e + +l lcl|NCBI__GCF_000025465.1:WP_012968564.1 146 SVVRQMKIALyglshqqALQILIAYEPVWAIGeHGTPASPQEAGVIHQALREALCErFGHETGIRIPLL 214 9999998887676655545679**********55******************9988799********** PP TIGR00419 197 yGasvtaaedaelaaqldvdGvLlasav 224 yG+svt ++++el q++++G+ ++ a lcl|NCBI__GCF_000025465.1:WP_012968564.1 215 YGGSVTLQNAVELLRQPEINGLFIGRAA 242 ************************9886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (264 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.91 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory