Align Methylisocitrate lyase (EC 4.1.3.30) (characterized)
to candidate WP_012969343.1 ALVIN_RS00470 methylisocitrate lyase
Query= reanno::Cup4G11:RR42_RS11260 (302 letters) >NCBI__GCF_000025485.1:WP_012969343.1 Length = 296 Score = 421 bits (1081), Expect = e-122 Identities = 217/293 (74%), Positives = 246/293 (83%), Gaps = 2/293 (0%) Query: 9 ARSAGARFRQALADEHPLQVVGTINANHALLAKRAGYRAIYLSGGGVAAGSLGLPDLGIS 68 A + GA+ R A+ +E PLQVVG INA HA +A+R GYRA+YLSGGGVAAGS G+PDLG++ Sbjct: 4 AMTPGAKLRLAVQEERPLQVVGAINAYHARMAERTGYRALYLSGGGVAAGSYGIPDLGMT 63 Query: 69 NLDDVLTDVRRITDVCDVPLLVDVDTGFGASAFNVARTTRSLIKFGAGAMHIEDQVGAKR 128 +LD+VL DV RIT + D+PLLVD DTG+G AFN+ART + LI+ GA HIEDQV AKR Sbjct: 64 SLDNVLEDVSRITYITDLPLLVDADTGWGG-AFNIARTVKQLIRAGAAGCHIEDQVAAKR 122 Query: 129 CGHRPGKEIVSQGEMADRIKAAVDARTDENFVIMARTDALAVEGLDKAIERAVACVEAGA 188 CGHRPGK IVSQ EM DRIKAAVDARTD+ FVIMARTDALAVEGLD AIERA ACVEAGA Sbjct: 123 CGHRPGKAIVSQAEMVDRIKAAVDARTDD-FVIMARTDALAVEGLDAAIERAQACVEAGA 181 Query: 189 DAIFPEAMTDLAMYRKFVDAVKVPVLANITEFGATPLFTTEELGGAGVSMVLYPLSAFRA 248 D IFPEAMT+LA Y +F AV+VPVLANITEFGATPLFTT ELG GVS+VLYPLSAFRA Sbjct: 182 DMIFPEAMTELAQYERFTAAVQVPVLANITEFGATPLFTTTELGAVGVSLVLYPLSAFRA 241 Query: 249 MNKAAENVYAAIRRDGTQQNVVDTMQTRAELYESIGYHAYEQKLDALFAQGKA 301 MNKAA NVY A+RRDGTQ NVVDTMQTR ELY+ + YH +EQKLDALFAQ ++ Sbjct: 242 MNKAALNVYQALRRDGTQANVVDTMQTRMELYDYLDYHHFEQKLDALFAQERS 294 Lambda K H 0.320 0.134 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 296 Length adjustment: 27 Effective length of query: 275 Effective length of database: 269 Effective search space: 73975 Effective search space used: 73975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_012969343.1 ALVIN_RS00470 (methylisocitrate lyase)
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.14944.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-131 422.2 2.4 5.3e-131 422.0 2.4 1.0 1 lcl|NCBI__GCF_000025485.1:WP_012969343.1 ALVIN_RS00470 methylisocitrate l Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025485.1:WP_012969343.1 ALVIN_RS00470 methylisocitrate lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.0 2.4 5.3e-131 5.3e-131 2 284 .. 8 290 .. 7 291 .. 0.99 Alignments for each domain: == domain 1 score: 422.0 bits; conditional E-value: 5.3e-131 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeearrit 69 g++lr ++++e +lq++Gaina++a +ae++G++a+YlsG+++aa s g+PDlg+t+l++v+e+++rit lcl|NCBI__GCF_000025485.1:WP_012969343.1 8 GAKLRLAVQEERPLQVVGAINAYHARMAERTGYRALYLSGGGVAAgSYGIPDLGMTSLDNVLEDVSRIT 76 6799***************************************999*********************** PP TIGR02317 70 rvtklpllvDaDtGfGealnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemvkkikaav 138 +t+lpllvDaDtG+G+a+n+artvk+l++ag+a++hieDqva+k+CGh++gk++vs+ emv++ikaav lcl|NCBI__GCF_000025485.1:WP_012969343.1 77 YITDLPLLVDADTGWGGAFNIARTVKQLIRAGAAGCHIEDQVAAKRCGHRPGKAIVSQAEMVDRIKAAV 145 ********************************************************************* PP TIGR02317 139 kakkdedfvliaRtDaraveGldaaieRakaYveaGadaiftealeseeefrefakavkvpllanmtef 207 +a++ +dfv++aRtDa aveGldaaieRa+a veaGad+if+ea+++++++++f++av+vp+lan+tef lcl|NCBI__GCF_000025485.1:WP_012969343.1 146 DART-DDFVIMARTDALAVEGLDAAIERAQACVEAGADMIFPEAMTELAQYERFTAAVQVPVLANITEF 213 ****.56************************************************************** PP TIGR02317 208 GktplltadeleelgykiviyPvtalRaalkaaekvyeelkkkGtqkelldklqtRkelYellgyedye 276 G tpl+t+ el +g+++v+yP++a+Ra++kaa +vy+ l+++Gtq +++d++qtR elY+ l+y+++e lcl|NCBI__GCF_000025485.1:WP_012969343.1 214 GATPLFTTTELGAVGVSLVLYPLSAFRAMNKAALNVYQALRRDGTQANVVDTMQTRMELYDYLDYHHFE 282 ********************************************************************* PP TIGR02317 277 kkdkelfk 284 +k++ lf+ lcl|NCBI__GCF_000025485.1:WP_012969343.1 283 QKLDALFA 290 ***99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (296 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.10 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory