Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate WP_012970856.1 ALVIN_RS08175 UDP-glucose 4-epimerase GalE
Query= metacyc::BSU38860-MONOMER (339 letters) >NCBI__GCF_000025485.1:WP_012970856.1 Length = 335 Score = 470 bits (1209), Expect = e-137 Identities = 221/335 (65%), Positives = 267/335 (79%) Query: 1 MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLL 60 M +LVTGGAGYIGSHTC+ELL +G +VV+DNL NS E+L RV EITG+ + F+E DL Sbjct: 1 MRVLVTGGAGYIGSHTCLELLQAGIHVVVIDNLCNSREESLRRVGEITGQAVGFFEVDLR 60 Query: 61 DREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIV 120 DREA+ +F++ +AVIHFAGLKAVGESVA PL+YY NN+ GT LC+ M + GV+ +V Sbjct: 61 DREALGEIFSQGRFDAVIHFAGLKAVGESVAQPLEYYDNNVQGTLTLCQVMAEAGVRNLV 120 Query: 121 FSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPF 180 FSSSATVYG P + PI EDFP+GATNPYG++KL +E+IL DLH +D W++ALLRYFNP Sbjct: 121 FSSSATVYGDPTSVPIREDFPVGATNPYGRSKLFIEEILHDLHVSDPRWNIALLRYFNPV 180 Query: 181 GAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAE 240 GAH SGRIGEDPNGIPNNLMPY+AQVAVG+L++L VFGNDYPT DGTGVRDYIHVVDLA Sbjct: 181 GAHESGRIGEDPNGIPNNLMPYIAQVAVGRLQRLRVFGNDYPTPDGTGVRDYIHVVDLAR 240 Query: 241 GHVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFA 300 GH+ AL K+ S G YNLGTG GYSVLE++ AFE+ SG+ VPY +RR GDIA C+A Sbjct: 241 GHLAALHKLQESPGVVTYNLGTGRGYSVLEVIAAFERASGRAVPYDIVERRSGDIACCYA 300 Query: 301 DPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGY 335 DP+ A+ ELGW A+ LE M D+WRWQS N +GY Sbjct: 301 DPSLARDELGWSAEYDLERMVVDAWRWQSQNPDGY 335 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 335 Length adjustment: 28 Effective length of query: 311 Effective length of database: 307 Effective search space: 95477 Effective search space used: 95477 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012970856.1 ALVIN_RS08175 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.28795.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-147 475.0 0.0 5.5e-147 474.9 0.0 1.0 1 lcl|NCBI__GCF_000025485.1:WP_012970856.1 ALVIN_RS08175 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025485.1:WP_012970856.1 ALVIN_RS08175 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 474.9 0.0 5.5e-147 5.5e-147 1 331 [. 2 334 .. 2 335 .] 0.99 Alignments for each domain: == domain 1 score: 474.9 bits; conditional E-value: 5.5e-147 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavle 67 ++LvtGgaGyiGsh++ +ll++g +vvv+Dnl+++ +e+l+++ +it +v ++e dl+d+e+l ++++ lcl|NCBI__GCF_000025485.1:WP_012970856.1 2 RVLVTGGAGYIGSHTCLELLQAGIHVVVIDNLCNSREESLRRVGEITgqAVGFFEVDLRDREALGEIFS 70 69********************************************9999******************* PP TIGR01179 68 eekidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEe 136 + ++daviHfa+l+avgEsv++Pl+YY+nnv++tl+L+++m++agv++l+Fsssa+vYg++++vpi E+ lcl|NCBI__GCF_000025485.1:WP_012970856.1 71 QGRFDAVIHFAGLKAVGESVAQPLEYYDNNVQGTLTLCQVMAEAGVRNLVFSSSATVYGDPTSVPIRED 139 ********************************************************************* PP TIGR01179 137 splnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevav 204 +p++++npYGrskl +E+il+dl+ +d+++++++LRYFn++GA+e+g+iGe++++++ +l++++a+vav lcl|NCBI__GCF_000025485.1:WP_012970856.1 140 FPVGATNPYGRSKLFIEEILHDLHVSDPRWNIALLRYFNPVGAHESGRIGEDPNGIPnNLMPYIAQVAV 208 *********************************************************9*********** PP TIGR01179 205 gkrekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkk 273 g++++l++fG+dypt+DGt+vRDyiHv Dla +Hlaal++l+e+ ++ +ynlG+g+g+sv+evi a+++ lcl|NCBI__GCF_000025485.1:WP_012970856.1 209 GRLQRLRVFGNDYPTPDGTGVRDYIHVVDLARGHLAALHKLQESPGVVTYNLGTGRGYSVLEVIAAFER 277 ********************************************************************* PP TIGR01179 274 vsgkdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekklkeg 331 +sg+ +++ + +rR+GD+a+++ad+s +++elgw+++yd Le ++ +aw+W++++++g lcl|NCBI__GCF_000025485.1:WP_012970856.1 278 ASGRAVPYDIVERRSGDIACCYADPSLARDELGWSAEYD-LERMVVDAWRWQSQNPDG 334 ***************************************.**************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (335 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.34 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory