Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_012975020.1 AZL_RS13085 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000010725.1:WP_012975020.1 Length = 274 Score = 240 bits (612), Expect = 3e-68 Identities = 114/252 (45%), Positives = 174/252 (69%), Gaps = 1/252 (0%) Query: 4 PILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIR 63 PIL V L+ FGG+LA+ ++ + + S+IGPNGAGKTT+FN +TG Y+P+GG + Sbjct: 23 PILTVEHLSREFGGVLAIGDLSFTIAAGDIHSIIGPNGAGKTTLFNLVTGVYKPSGGRVL 82 Query: 64 LDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAF 123 DG ++ G+ +++A +G+ RTFQN+++F MTA+EN++V +H HL+T L LF+ P+ Sbjct: 83 FDGADMSGMAPYRLAARGMSRTFQNLQIFFNMTALENVMVGRHLHLDTRLLPALFRFPSL 142 Query: 124 RRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAG 183 R +REA + A + +V L + + A ++ YG +RLEIAR + + P++L+LDEPAAG Sbjct: 143 ARKDREAKDRAVLLMSQVGLARYIDADAASMPYGALKRLEIARALASEPKLLLLDEPAAG 202 Query: 184 LNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRD 243 LN E+ ++ +I + + VT++L+EHDMK+VM IS I +NQG LA+GTP+++ Sbjct: 203 LNATESREIDEVIKSVAAT-GVTIVLVEHDMKMVMGISHRITALNQGRLLAEGTPQEVAA 261 Query: 244 NPDVIKAYLGEA 255 NPDVI AYLG A Sbjct: 262 NPDVIAAYLGAA 273 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 274 Length adjustment: 25 Effective length of query: 230 Effective length of database: 249 Effective search space: 57270 Effective search space used: 57270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory