Align phosphoserine aminotransferase monomer (EC 2.6.1.52; EC 2.6.1.1) (characterized)
to candidate WP_012977212.1 AZL_RS25025 phosphoserine transaminase
Query= metacyc::MONOMER-15918 (370 letters) >NCBI__GCF_000010725.1:WP_012977212.1 Length = 394 Score = 456 bits (1172), Expect = e-133 Identities = 226/379 (59%), Positives = 272/379 (71%), Gaps = 10/379 (2%) Query: 2 KPTRVPKNPCFSSGPCAKHPGYSVEELKDTPFGRSHRSKPGKEKLAEAIKRTRDMLGLPD 61 +P+R P P FSSGPCAK PG+S++ L GRSHRSKPGK KL E I TR +LG+P Sbjct: 8 RPSRRPDTPLFSSGPCAKRPGWSLDALDGALLGRSHRSKPGKAKLKEVIDLTRAVLGIPG 67 Query: 62 DYFVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDTRVFEAEY 121 DY +GIVPASDTGA EM LWS+LG RGVD+L WESF K W TD+ QLKL D R A Y Sbjct: 68 DYRIGIVPASDTGAVEMALWSLLGPRGVDMLAWESFGKEWVTDVANQLKLPDVRNLIAPY 127 Query: 122 GKLPDLKKVDFKNDVVFVWNGTTSGVKVPNADWIPDDREGVTLCDATSAIFAMDIPYHKL 181 G+LPDL VDF DVVF WNGTT+GV+V + DWI DDR G+T+CDATSA FAM +P+HKL Sbjct: 128 GELPDLSSVDFSRDVVFTWNGTTAGVRVADGDWIADDRAGLTICDATSAAFAMALPWHKL 187 Query: 182 DVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKDIFAGST 241 DV T+SWQKVLGGE AHGML+L PRAV+RLES+ P PLPKIFR+TK GKL + IF G T Sbjct: 188 DVATWSWQKVLGGEAAHGMLVLGPRAVERLESFQPDRPLPKIFRMTKNGKLIEGIFEGDT 247 Query: 242 INTPSMLANEDWLATLKWAESVGGLKQLIRRTNENLAVFEAFVAKNNWIHFLAETKEIRS 301 INTPSML ED + L+WA S+GGL LIRR+ +NL + +V + W FLA+ RS Sbjct: 248 INTPSMLCVEDAIDGLRWALSLGGLTPLIRRSEQNLRIVAEWVETSPWAGFLAKDPANRS 307 Query: 302 STSVCFK------VDLSDEK----LKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVE 351 TS+C + LS+E K+L LEKE+ A+D GSYRDAP GLR+W GATVE Sbjct: 308 CTSICLRFTDPEVTALSEEAQAAFAKKLSALLEKEEAAFDAGSYRDAPPGLRLWGGATVE 367 Query: 352 KEDLECLCEWIEWAYNLVK 370 ED+E + W++WA+ VK Sbjct: 368 NEDMEAVLPWLDWAFATVK 386 Lambda K H 0.319 0.136 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 522 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 394 Length adjustment: 30 Effective length of query: 340 Effective length of database: 364 Effective search space: 123760 Effective search space used: 123760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory