Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) (characterized)
to candidate WP_012978469.1 AZL_RS31805 3-hydroxybutyryl-CoA dehydrogenase
Query= BRENDA::Q0KEY8 (284 letters) >NCBI__GCF_000010725.1:WP_012978469.1 Length = 288 Score = 392 bits (1006), Expect = e-114 Identities = 193/282 (68%), Positives = 229/282 (81%) Query: 3 IRTVGIVGAGTMGNGIAQACAVVGLNVVMVDISDAAVQKGVATVASSLDRLIKKEKLTEA 62 I T+G++GAGTMGNGIAQ CAV GL VVM DIS+AAVQ+G++TV SLDRL+KKEK+T A Sbjct: 7 IETIGVIGAGTMGNGIAQVCAVAGLTVVMTDISEAAVQRGLSTVGGSLDRLVKKEKMTAA 66 Query: 63 DKASALARIKGSTSYDDLKATDIVIEAATENYDLKVKILKQIDGIVGENVIIASNTSSIS 122 D+ +ALARI +T L D+VIEAATEN DLK+KILK + ++ ++A+NTSSIS Sbjct: 67 DRETALARITATTDKSKLGTCDLVIEAATENEDLKIKILKDLCALLKPEALVATNTSSIS 126 Query: 123 ITKLAAVTSRADRFIGMHFFNPVPVMALVELIRGLQTSDTTHAAVEALSKQLGKYPITVK 182 ITKLA T R DRFIG+HFFNPVP+MAL+E+IRG+QTSD THA A +K++GK PIT K Sbjct: 127 ITKLATATDRPDRFIGLHFFNPVPLMALLEIIRGIQTSDDTHAKAMAFAKRVGKSPITAK 186 Query: 183 NSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGCNHPIGPLALADMIGLDTMLA 242 NSPGF VNRILCPMINEA L +G+A+ E+ID GMK GCNHPIGPLALAD+IGLDTML+ Sbjct: 187 NSPGFAVNRILCPMINEAIFALQDGIATAEDIDAGMKAGCNHPIGPLALADLIGLDTMLS 246 Query: 243 VMEVLYTEFADPKYRPAMLMREMVAAGYLGRKTGRGVYVYSK 284 VMEV Y F DPKYRPA L++EMV AGYLGRKTGRG Y YSK Sbjct: 247 VMEVFYEGFNDPKYRPAPLLKEMVDAGYLGRKTGRGFYDYSK 288 Lambda K H 0.319 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 288 Length adjustment: 26 Effective length of query: 258 Effective length of database: 262 Effective search space: 67596 Effective search space used: 67596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory