Align Gluconolactonase (characterized, see rationale)
to candidate WP_012978499.1 AZL_RS31975 SMP-30/gluconolactonase/LRE family protein
Query= uniprot:A0A165IRV8 (316 letters) >NCBI__GCF_000010725.1:WP_012978499.1 Length = 296 Score = 200 bits (509), Expect = 3e-56 Identities = 120/297 (40%), Positives = 159/297 (53%), Gaps = 15/297 (5%) Query: 26 RCVIALGNALGEGVLWSVREQAVYWVDILGRELHRWDPATGAHQRWTFDEEISAIAERAH 85 RCV LGEG LWS R+ AVY+VDI G + R + G+ W D+ + E A Sbjct: 6 RCVWQARALLGEGPLWSPRQDAVYFVDIRGARILRHGLSDGSQAVWELDDAACWLVEDAD 65 Query: 86 APGFIVTLRRGFAL---FDPATDMAPRYLHQPEPDRAGNRFNDGKCDAQGRFWAGSMDFA 142 GF+ LR + +P + + + EPD+ GNR NDGK D GR W GSMD + Sbjct: 66 GDGFVAGLRSRRVVRLRLEPGRALIGGEIARIEPDKPGNRLNDGKADRAGRLWIGSMDDS 125 Query: 143 CEAPTGALYRYDSDGSCTRHDDGFAVTNGPTWSGTGQGAAMFFNATIEGNTYRY----DS 198 EAP G YR D+DG+ TR D+G+ V NGP + G+ ++ + Y + D Sbjct: 126 EEAPAGGFYRIDADGAVTRVDEGYTVANGPALAPDGR--TIYHTDSAARTVYAFDIGADG 183 Query: 199 DLATGTVSNKTLWKHWLPEDGLPDGMTTDAQGRLWIAHWGGWCVTCHDPVTAAELGRVRL 258 L+ G++S K + + DG PDGMT DA+G LW+ HW G V+ P + + L Sbjct: 184 GLSDGSLSGKRVHIRFGEADGYPDGMTCDAEGGLWVCHWDGGRVSRFHPDGTFDRA-IAL 242 Query: 259 PVSQVTTCAFGGADLRTLFISSARVGLTPEQLAAEPLAGALFAVDTDSLGLPAHPFG 315 PVS+VT+C F G DL LFI++A G PE EPLAGALF D GLP FG Sbjct: 243 PVSRVTSCVFAGPDLDRLFITTAAHG-RPE----EPLAGALFECDPGVRGLPPGRFG 294 Lambda K H 0.321 0.137 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 296 Length adjustment: 27 Effective length of query: 289 Effective length of database: 269 Effective search space: 77741 Effective search space used: 77741 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory