Align GguB aka ATU2346 aka AGR_C_4262, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate WP_012978503.1 AZL_RS31995 sugar ABC transporter permease
Query= TCDB::O05177 (398 letters) >NCBI__GCF_000010725.1:WP_012978503.1 Length = 399 Score = 500 bits (1288), Expect = e-146 Identities = 248/383 (64%), Positives = 315/383 (82%) Query: 15 SVGSYIRSNIREYGMLIALVAIMVFFQFYTGGILFRPVNLTNLILQNSFIVIMALGMLLV 74 S+ +++S++R+YGMLI+L+AI+ FFQ+ T G L +P+NLTNL+LQNS+IVIMALGMLLV Sbjct: 16 SMAKFLKSHMRDYGMLISLLAIVAFFQYMTNGTLLQPLNLTNLVLQNSYIVIMALGMLLV 75 Query: 75 IVAGHIDLSVGSIVAFVGAIAAILTVQWGMNPFLAALICLVIGGIIGAAQGYWIAYHRIP 134 IVAGHIDLSVGSIV F+GA+AAIL VQ+ + A++ L+ G IGAAQGYW+AY RIP Sbjct: 76 IVAGHIDLSVGSIVGFIGALAAILMVQFHWHFIPTAIVSLIAGAAIGAAQGYWVAYFRIP 135 Query: 135 SFIVTLAGMLVFRGLTLFVLGGKNIGPFPTDFQVISTGFLPDIGGIEGLNTTSMILTVLI 194 SFIVTLAGMLVFRGL+L +L G+++GPFP +FQ +S+GF+PD G EG +TT+++L + Sbjct: 136 SFIVTLAGMLVFRGLSLALLAGQSVGPFPVEFQRLSSGFIPDFFGTEGFHTTTLLLCLAT 195 Query: 195 TVALFYLAWRRRVVNVKHGIDVEPFGFFIVQNLLISGAILFLGYQLSTYRGLPNVLIVML 254 + + R+ + I+ EP F++++ + + ++G+ LSTY+GLPNVLI+M Sbjct: 196 PAIMIGFSIAARLRRHRFAIEQEPLVLFLLKSAGLFAVVAYVGWLLSTYKGLPNVLIIMA 255 Query: 255 VLIALYSFVTRRTTIGRRVYAMGGNEKATKLSGINTERLSFLTFVNMGVLAGLAGMIIAT 314 +LI LY+FVTR TTIGRR+YA+GGNEKA KLSGI+T RLSF TFVNMGVLA LAG+I A Sbjct: 256 LLIGLYAFVTRDTTIGRRIYALGGNEKAAKLSGIDTRRLSFYTFVNMGVLAALAGLIFAA 315 Query: 315 RLNSATPKAGVGFELDVIAACFIGGASASGGVGKITGAVIGAFIMGVMNNGMSIVGLGID 374 RLN+ATPKAGV FELDVIAACFIGGASASGGVG++TGAVIGAFIMGVMNNGMSI+G+GID Sbjct: 316 RLNTATPKAGVSFELDVIAACFIGGASASGGVGRVTGAVIGAFIMGVMNNGMSILGIGID 375 Query: 375 FQQMVKGLVLLAAVFFDVYNKNK 397 +QQ++KGLVLLAAV FDVYNK K Sbjct: 376 WQQVIKGLVLLAAVCFDVYNKGK 398 Lambda K H 0.329 0.145 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 622 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 399 Length adjustment: 31 Effective length of query: 367 Effective length of database: 368 Effective search space: 135056 Effective search space used: 135056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory