Align 4-hydroxy-2-oxoglutarate aldolase (EC 4.1.3.16; EC 4.1.2.55) (characterized)
to candidate WP_012978537.1 AZL_RS32180 2-dehydro-3-deoxy-phosphogluconate aldolase
Query= metacyc::MONOMER-4906 (205 letters) >NCBI__GCF_000010725.1:WP_012978537.1 Length = 217 Score = 126 bits (317), Expect = 3e-34 Identities = 68/171 (39%), Positives = 100/171 (58%), Gaps = 2/171 (1%) Query: 12 IVAVLRANSVEEAKEKALAVFEGGVHLIEITFTVPDADTVIKELSFLKEKGAIIGAGTVT 71 +V V+R +S + A+ + E G EIT T P A +I+ELS GA+IGAGTV Sbjct: 19 VVPVIRNSSADLARTAVTWLREAGYGTFEITMTTPGAVGLIEELS--AAGGALIGAGTVL 76 Query: 72 SVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLF 131 + V++GA ++VSP + +++ C++ GV + G +TPTE+ A+ G +K+F Sbjct: 77 TPAAVADVVKAGARYVVSPCVVPKVAAACRDHGVACLMGALTPTEVHAAISAGADAIKIF 136 Query: 132 PGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALV 182 P VGP +KA+K FP V+FVPTGG++ V + AGV VG G LV Sbjct: 137 PASTVGPAHIKALKSVFPGVRFVPTGGIDATTVASYVAAGVACVGAGGKLV 187 Lambda K H 0.318 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 217 Length adjustment: 21 Effective length of query: 184 Effective length of database: 196 Effective search space: 36064 Effective search space used: 36064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory