Align ABC transporter permease (characterized, see rationale)
to candidate WP_013010794.1 DACET_RS07580 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KC95 (309 letters) >NCBI__GCF_000025725.1:WP_013010794.1 Length = 301 Score = 249 bits (635), Expect = 7e-71 Identities = 127/311 (40%), Positives = 205/311 (65%), Gaps = 14/311 (4%) Query: 1 MDILLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQ-- 58 MDILLQQI+NGL +GS+YAL+ALGYTMVYG+++LINFAHG+++ + A M Sbjct: 1 MDILLQQIVNGLTIGSIYALVALGYTMVYGVMKLINFAHGDLVALSAYIGLVFYTQMAAG 60 Query: 59 GAMPGAPGWVILLLATIIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTL 118 GAMP A + ++L ++ +V A ++E++AYRPLR++PRL+ +++A+G S+++Q Sbjct: 61 GAMPQA---LTIVLVFLLTAIVVAIFGVLLERIAYRPLRNAPRLSAVVSALGASMMIQNG 117 Query: 119 AMIIWKPNYKPYPT-MLPSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGRAM 177 M++W PN +P+ +LP++ + I G IT Q ++ +T + + +L +N T +G A+ Sbjct: 118 IMLVWGPNILIFPSDILPATSWNIYGVTITFVQAAMIIITIMLMLALTLFINFTKMGTAI 177 Query: 178 RATAENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKAFT 237 RA+A N A LMG+ + +I F++G++L A+ G+ Y +G+ G+ AF Sbjct: 178 RASAINQDAAKLMGINVNFIIIIIFVLGSMLGAVGGLFIGMYYRGISFNLGWTYGMSAFI 237 Query: 238 AAVFGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTLRP 297 AA+ GGIGN+ G++VGG LLGL A+ +GY+ S + + F +I+LI+IL +RP Sbjct: 238 AAILGGIGNIPGSMVGGYLLGLFTALIAGYV--------SSAWAEAFTYILLIMILIVRP 289 Query: 298 SGLLGERVADR 308 +G+LGERVA++ Sbjct: 290 TGILGERVAEK 300 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 301 Length adjustment: 27 Effective length of query: 282 Effective length of database: 274 Effective search space: 77268 Effective search space used: 77268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory