Align 3-hydroxybutyryl-CoA dehydrogenase; EC 1.1.1.157 (characterized)
to candidate WP_013075261.1 BTUS_RS06190 hypothetical protein
Query= CharProtDB::CH_091789 (282 letters) >NCBI__GCF_000092905.1:WP_013075261.1 Length = 295 Score = 234 bits (596), Expect = 2e-66 Identities = 118/282 (41%), Positives = 182/282 (64%), Gaps = 2/282 (0%) Query: 1 MKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDRGLDFINKNLSKLVKKGKIEEA 60 +K++ V+G G MG GIA A GFE + D + E +++ L+ I + + +KG + E Sbjct: 4 VKRIGVVGTGVMGQGIAYQAAVSGFETWMYDARPEALEKALEQIAALVKRQKEKGFLREE 63 Query: 61 TKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQIFADLDNICKPETILASNTSSLS 120 ++L R+ L CD VIEA E + +K ++F +LD +C P+ +LA+NTS+ S Sbjct: 64 PG-DVLGRLRTASSLGELGGCDFVIEAVTEDLAVKHRVFRELDGVCAPDVVLATNTSAKS 122 Query: 121 ITEVASATKRPDKVIGMHFFNPAPVMKLVEVIRGIATSQETFDAVKETSIAIGKDPVEVA 180 ITE+A+A P++V+GMHFFNP M+LVEV+RG+ +++ + + ++GK+ + V Sbjct: 123 ITEIAAAAAMPERVVGMHFFNPVHRMELVEVVRGLESAEWAVEQTEVVGRSLGKETIRVQ 182 Query: 181 EAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAMKLGANHPMGPLELGDFIGLDICLA 240 E PGF +RI + NEA +L EG++SVE+IDKA+KLG + PMGP ELGD +G D L Sbjct: 183 ERPGFATSRISALIGNEAFYMLMEGVSSVEEIDKAIKLGLHFPMGPFELGDLVGWDTRLH 242 Query: 241 IMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGKGFYDYSK 282 +++ L+ G+ K+RP LL +YVRAG LG+K G+G Y+Y + Sbjct: 243 VLEYLHQTLGE-KFRPCPLLVQYVRAGRLGKKVGRGVYEYDE 283 Lambda K H 0.319 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 295 Length adjustment: 26 Effective length of query: 256 Effective length of database: 269 Effective search space: 68864 Effective search space used: 68864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory