Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_013075277.1 BTUS_RS06270 3-oxoacyl-ACP reductase FabG
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_000092905.1:WP_013075277.1 Length = 246 Score = 160 bits (404), Expect = 3e-44 Identities = 101/254 (39%), Positives = 151/254 (59%), Gaps = 16/254 (6%) Query: 1 MDLKDKVVVITGGAGGLGLAMAHNFAQAGAKLALIDVDQDKLERACADLGS-STEVQGYA 59 MDL K+ ++TG A G+G +A A+ GA + + D+DQ+ + ++ S +G Sbjct: 1 MDLTGKIAIVTGAAKGIGREIAFLLAKHGADVTVADLDQEGADAVAEEIRSLGRRSRGVQ 60 Query: 60 LDITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVIN 119 +++ + +V A +E FG +++LVNNAGI RD ML K M+ +QF VI Sbjct: 61 VNVANRPEVTAMVRDTIEHFGDLDILVNNAGITRDAMLHK---------MTEEQFDEVIA 111 Query: 120 VNLTGTFLCGREAAAAMIESGQAGVIVNISSLA-KAGNVGQSNYAASKAGVAAMSVGWAK 178 V++ GTFLC + AA M E + G IVNISS+A K GN+GQ NY+ +KAG+ M+ AK Sbjct: 112 VHMKGTFLCMQAAAIHMREK-RKGKIVNISSIAGKVGNIGQVNYSGAKAGIVGMTKAAAK 170 Query: 179 ELARYNIRSAAVAPGVIATEMTAAMKPEALERLE-KLVPVGRLGHAEEIASTVRFIIE-- 235 ELA+Y + AV PG I T+MT A+ PE + +++ +P+ R+G +IA V F+ Sbjct: 171 ELAKYGVCVNAVQPGFIDTDMTRAV-PEKVRQIKIAEIPMERIGVPLDIAKAVVFLSSDY 229 Query: 236 NDYVNGRVFEVDGG 249 +DY+ G V EV GG Sbjct: 230 SDYMTGTVLEVTGG 243 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 246 Length adjustment: 24 Effective length of query: 228 Effective length of database: 222 Effective search space: 50616 Effective search space used: 50616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory