Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33 (characterized, see rationale)
to candidate WP_013076329.1 BTUS_RS11950 3-isopropylmalate dehydratase small subunit
Query= uniprot:Q845W4 (216 letters) >NCBI__GCF_000092905.1:WP_013076329.1 Length = 204 Score = 229 bits (585), Expect = 2e-65 Identities = 120/206 (58%), Positives = 143/206 (69%), Gaps = 11/206 (5%) Query: 1 MEKFTVHTGVVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNAFDEWRYLDHGEPGQDNSK 60 ME F H G+V PLDR NVDTD IIPKQFLK I+RTGFG F +WR+ + G P Sbjct: 1 MEPFVRHEGLVLPLDRVNVDTDQIIPKQFLKRIQRTGFGQFLFYDWRFREDGSP------ 54 Query: 61 RPLNPDFVLNQPRYQGASILVTRKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFFNNC 120 +P F+LN P Y+ ASIL+ R NFGCGSSREHAPWALQ YGFR IIAPSFADIF+NNC Sbjct: 55 ---DPKFILNHPEYREASILLARDNFGCGSSREHAPWALQDYGFRVIIAPSFADIFYNNC 111 Query: 121 FKNGLLPIVLTEQQVDHLINETVAFNG-YQLTIDLEAQVVRTPDGRDYPFEITAFRKYCL 179 FKNGLLP+VL + V+HL +E G Y+LT+DLE+Q V G FEI FR+ L Sbjct: 112 FKNGLLPLVLPGETVNHLFDEAGRIPGRYRLTVDLESQEVWDNRGWQTRFEIDPFRRESL 171 Query: 180 LNGFDDIGLTLRHADKIRQFEAERLA 205 L G DDIG+TL D+I +E +R+A Sbjct: 172 LKGLDDIGVTLEKEDRIAGYE-QRMA 196 Lambda K H 0.322 0.141 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 204 Length adjustment: 21 Effective length of query: 195 Effective length of database: 183 Effective search space: 35685 Effective search space used: 35685 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_013076329.1 BTUS_RS11950 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.25529.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.25529.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.