Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate WP_013076344.1 BTUS_RS12035 long-chain fatty acid--CoA ligase
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >NCBI__GCF_000092905.1:WP_013076344.1 Length = 521 Score = 262 bits (670), Expect = 2e-74 Identities = 174/523 (33%), Positives = 258/523 (49%), Gaps = 51/523 (9%) Query: 58 TYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVNINPAYRT 117 TY Q+ R A L G+ GDRV I N +V+ A G ++V +NP Y Sbjct: 37 TYEQVWWMVQRAAVGLAAAGVRKGDRVAIMLPNCPHYVIAYYAVLVAGGIVVQVNPMYTG 96 Query: 118 AEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTVVWID 177 AE+E+ L K++V+ Y + ++ W+ HL+ A L Q V Sbjct: 97 AELEHLLVDADPKVIVA--------YEPLWGKIEAVWENT---HLERAYLVQFPGPV--- 142 Query: 178 DEAGQGADEPGLLRFTELIAR-GNAADPRLAQVAAGLQATDPINIQFTSGTTGFPKGATL 236 P R + A G DP + + D +Q+T GTTG+ KGA L Sbjct: 143 -------QTPATERVQPVEALLGAQGDPP----SVAISPEDTAVLQYTGGTTGYSKGAML 191 Query: 237 THRNILNN----------GFFIGECMKLTPADRLCIPVPLYHCFGMVLG-NLACFTHGAT 285 THRN++ N G GE + + + +PL+H +GM +G NL Sbjct: 192 THRNLVANVYQSLADFRDGLRDGE-------EVILLVLPLFHVYGMTVGMNLGIAVGANL 244 Query: 286 IVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPRFAEFNLSTLRTGIMAGSPCP 345 ++ P D VL ++ + T GVPTM++A HP+ E+ + ++R +P P Sbjct: 245 VMLPRFQVDE--VLDAIKAAKPTMFPGVPTMYVAVNSHPKAREYGIDSIRICNSGSAPLP 302 Query: 346 TEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTPLSKRVSTVGQVQPHLEVKIVDPD 405 EV+ R E +I YG+TE SPV+ + ++V ++G E +IVD Sbjct: 303 VEVL-RAFEAKTGAKILEGYGLTEASPVTHTNPYHGV--RKVGSIGLPVAGTEARIVDVA 359 Query: 406 TGAV-VPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHTGDLATMDAEGYVNIVG 464 TG +P G+ GE +G VM GYW +T + + GW+HTGD+AT D +GY IV Sbjct: 360 TGLQELPPGEPGELVVRGPQVMKGYWNRPEETAQVL-RNGWLHTGDIATRDEDGYYYIVD 418 Query: 465 RIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQPTED 524 R KD++I G N+YPRE+EE LY HP +Q+ VVGVPD GE + A+++ KPG T D Sbjct: 419 RKKDIIIASGFNVYPREVEEVLYTHPGIQEAAVVGVPDPYRGETVKAYVVCKPGVTLTRD 478 Query: 525 DIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIRDEMK 567 ++ AFC+ ++AHYK P + F P + GKI + +RD + Sbjct: 479 EVIAFCRERMAHYKAPTEVEFREELPKSSVGKILRRALRDSQQ 521 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 750 Number of extensions: 43 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 578 Length of database: 521 Length adjustment: 36 Effective length of query: 542 Effective length of database: 485 Effective search space: 262870 Effective search space used: 262870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory