GapMind for catabolism of small carbon sources

 

Protein WP_013076931.1 in Kyrpidia tusciae DSM 2912

Annotation: NCBI__GCF_000092905.1:WP_013076931.1

Length: 462 amino acids

Source: GCF_000092905.1 in NCBI

Candidate for 19 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-threonine catabolism RR42_RS28305 hi D-serine/D-alanine/glycine transporter (characterized, see rationale) 65% 96% 620.2 L-alanine and D-alanine permease 59% 554.7
D-alanine catabolism cycA hi L-alanine and D-alanine permease (characterized) 59% 94% 554.7 Proline-specific permease (ProY) 49% 479.2
L-alanine catabolism cycA hi L-alanine and D-alanine permease (characterized) 59% 94% 554.7 Proline-specific permease (ProY) 49% 479.2
L-proline catabolism proY med Proline-specific permease (ProY) (characterized) 49% 98% 479.2 L-alanine and D-alanine permease 59% 554.7
phenylacetate catabolism H281DRAFT_04042 med Aromatic amino acid transporter AroP (characterized, see rationale) 47% 98% 436 L-alanine and D-alanine permease 59% 554.7
L-histidine catabolism permease med histidine permease (characterized) 46% 96% 429.1 L-alanine and D-alanine permease 59% 554.7
L-phenylalanine catabolism aroP med Aromatic amino acid transport protein AroP (characterized, see rationale) 46% 95% 428.7 L-alanine and D-alanine permease 59% 554.7
L-tryptophan catabolism aroP med Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) 46% 97% 423.7 L-alanine and D-alanine permease 59% 554.7
L-tyrosine catabolism aroP med Aromatic amino acid:H+ symporter, AroP of 457 aas and 12 TMSs (Cosgriff and Pittard 1997). Transports phenylalanine, tyrosine and tryptophan (characterized) 46% 97% 423.7 L-alanine and D-alanine permease 59% 554.7
D-serine catabolism cycA med D-serine/D-alanine/glycine transporter (characterized) 45% 97% 423.3 L-alanine and D-alanine permease 59% 554.7
L-asparagine catabolism ansP med Asparagine permease (AnsP) of 497 aas and 12 TMSs (characterized) 45% 90% 399.8 L-alanine and D-alanine permease 59% 554.7
L-arginine catabolism rocE lo Amino-acid permease RocE (characterized) 38% 96% 334 L-alanine and D-alanine permease 59% 554.7
L-lysine catabolism lysP lo The lysine specific transporter, LysP of 488 aas and 12 TMSs (characterized) 39% 95% 325.5 L-alanine and D-alanine permease 59% 554.7
L-serine catabolism serP lo Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) 36% 97% 294.7 L-alanine and D-alanine permease 59% 554.7
L-threonine catabolism serP1 lo Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized) 36% 97% 294.7 L-alanine and D-alanine permease 59% 554.7
L-isoleucine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 32% 86% 238.4 L-alanine and D-alanine permease 59% 554.7
L-leucine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 32% 86% 238.4 L-alanine and D-alanine permease 59% 554.7
L-valine catabolism Bap2 lo Arbuscular mycorrhizal fungal proline:H+ symporter, AAP1 (binds and probably transports nonpolar, hydrophobic amino acids) (characterized) 32% 86% 238.4 L-alanine and D-alanine permease 59% 554.7
L-tryptophan catabolism TAT lo tryptophan permease (characterized) 30% 72% 198 L-alanine and D-alanine permease 59% 554.7

Sequence Analysis Tools

View WP_013076931.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPEESELVRGLKERHLQLIALGGAIGVGLFLGSARAIHLAGPALTISYLVGGLVIFLIMR
ALGELALYKPVAGSFSTYAEEFVGPWAGFITGWTYWFMWITTAMAEITAVGVYVRYWFPA
VPQWLPALIALVVMFLVNLIAVGAYGEFEFWFALIKVVTIVAMIVVGLLIILFGVWNQGV
PVGFSNLWSHGGFFPTGIGGALLALQMVMFAYVGVELIGVTAGEARDPSKTIPSATNKII
WRILIFYVGALVIIMSLYPWNELDAQNSPFVLTFQRIGFPAAADVINFVVLTAALSSCNS
GVFSTGRMLYSLAQYGQAPRFLRGLSSRRVPAAAIAASAAVMLVGVILNYVVPQQVFTYV
TSLGAEAAIWTWGMILVAHMAYRRRVAAGQVQAVKYRMPGSPVTNWIGLAFLALVVVLLL
FDPDTRVAFYVALVWFAILVIAYQFVRRRAGHGAGAEGPDRP

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory