Align Solute-binding (Aliphatic amino acid) component of ABC transporter (characterized, see rationale)
to candidate WP_013076965.1 BTUS_RS15275 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:Q1MDE9 (367 letters) >NCBI__GCF_000092905.1:WP_013076965.1 Length = 388 Score = 180 bits (457), Expect = 5e-50 Identities = 115/346 (33%), Positives = 175/346 (50%), Gaps = 5/346 (1%) Query: 22 ADITIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILGEKVVLELADDAGEPKQGVS 81 A + IGL APL+G A++G ++ A A++EIN+ GGILG + DD + ++ Sbjct: 42 APVKIGLSAPLSGSTASWGTDYRDAAALAIEEINQSGGILGHPIQFVAEDDTMSNEGALN 101 Query: 82 AANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPTATAPDLTKRGLTNVLRTCGR 141 A+++V + + V+GP++S A+ V ++ GVLM P A+ P LT+ G NV R + Sbjct: 102 VASRLVDEKVIAVLGPLSSSTAMATEQVYSQGGVLMFPP-ASNPKLTQMGFDNVFRMSPK 160 Query: 142 DDQQAEVAAKYVLKNFKDKRVAIVNDKGAYGKGLADAFKATLNAGGITEVVNDAITPGDK 201 DDQ + AK + K A+++D Y KGLA FK G V +AITPG+K Sbjct: 161 DDQFGAMDAKVAAERLGAKTAAVIHDNSTYSKGLATYFKDAFEQMGGKVVDFEAITPGEK 220 Query: 202 DFSALTTRIKSEKVDVVYFGGYHPEGGLLARQLHDLAANATIIGGDGLSNTEFWAIGTDA 261 D+S + T+IKS D+ Y+ GY+PEG L +Q L + G+ + +F A+ A Sbjct: 221 DYSPVLTKIKSMNPDLFYYSGYYPEGAALVKQGKALGLETQYLMGNSNYDQQFIALAGPA 280 Query: 262 AGGTIFTNASDATK-SPDSKAAADALAAKNIPAEAFTLN--AYAAVEVLKAGIEKAGSAE 318 A + + T S D A + E L AY +V +LK IEKA S Sbjct: 281 AENVVMETLTPVTLISSDQAQKYVARYKEKYGKEPGFLGHLAYDSVHILKQAIEKAHSL- 339 Query: 319 DAEAVATALKDGKEIPTAIGKVTYGETGDLTSQSFSLYKWEAGKIV 364 +A+ T L+D GK+T+ + GD+ + + GK V Sbjct: 340 SFDAIKTVLRDPGGFQGIAGKITFDKNGDIQGSPSIILTVKNGKFV 385 Lambda K H 0.312 0.131 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 388 Length adjustment: 30 Effective length of query: 337 Effective length of database: 358 Effective search space: 120646 Effective search space used: 120646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory