Align 2-keto-3-deoxy-galactonokinase (characterized, see rationale)
to candidate WP_013090558.1 BC1002_RS13360 2-dehydro-3-deoxygalactonokinase
Query= uniprot:B2SYR9 (350 letters) >NCBI__GCF_000092885.1:WP_013090558.1 Length = 371 Score = 542 bits (1397), Expect = e-159 Identities = 281/353 (79%), Positives = 305/353 (86%), Gaps = 8/353 (2%) Query: 4 AGSPTQAAGHAAAVAVDASHEHAALIALDWGTTSLRAYLYDASGNVLATRASTAGIMNLP 63 AG ++A A A D +H AALIALDWGTTSLRAYL+DA G VLATRASTAGIMNLP Sbjct: 20 AGVKSEATDGTDAAADDFTH--AALIALDWGTTSLRAYLFDAHGRVLATRASTAGIMNLP 77 Query: 64 RSAEQGGFDAAFDDTCGAWLAHAPAAPVIAAGMVGSAQGWLEAPYVDTPASADALVAGIV 123 RSA +GGFDAAFDD CGAWL HA PVIAAGMVGSAQGWLEAPYV+TPA+ADALVAGIV Sbjct: 78 RSAAEGGFDAAFDDACGAWLDHARGVPVIAAGMVGSAQGWLEAPYVETPANADALVAGIV 137 Query: 124 RVKAACGVTLHIVPGVLQRGELPNVMRGEETQIFGALG------EETNTADSGKRSLIGL 177 RV+ A G TLHIVPGVLQRGELPNVMRGEETQI GAL ++ + DS RSLIGL Sbjct: 138 RVQTARGATLHIVPGVLQRGELPNVMRGEETQIVGALSADADGAQDASAVDSNARSLIGL 197 Query: 178 PGTHAKWAVVQADRIERFHTFMTGEVFAALREHTILGRTMLTPDSPDTSAFLHGVNIARE 237 PGTHAKWA+VQA+RIERFHTFMTGEVFAALREHTILGRTM+TPD PDT AFL GVNIARE Sbjct: 198 PGTHAKWALVQAERIERFHTFMTGEVFAALREHTILGRTMVTPDRPDTEAFLRGVNIARE 257 Query: 238 KGQAGVLATVFSSRTLGLTGQLSREQQPDYLSGLLIGHELAGLDAVLAQQQSALAGQSLR 297 KGQAGVLATVFS+RTLGLTG LS E QPDYLSGLLIGHELAGL+AVLAQQ S+LA QSLR Sbjct: 258 KGQAGVLATVFSTRTLGLTGALSSEAQPDYLSGLLIGHELAGLEAVLAQQGSSLAQQSLR 317 Query: 298 LIGNEALCERYRLALAQFGCTQAELVKHATERGLWRVASQAGLVKPAAKTARA 350 LIGN+ALCERYRLALAQFGC +AE V+HATERGLWRVA +AGLV+P+A+ ARA Sbjct: 318 LIGNDALCERYRLALAQFGCLRAEPVRHATERGLWRVAVEAGLVRPSAQAARA 370 Lambda K H 0.318 0.131 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 371 Length adjustment: 29 Effective length of query: 321 Effective length of database: 342 Effective search space: 109782 Effective search space used: 109782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory