GapMind for catabolism of small carbon sources

 

Protein WP_013093230.1 in Paraburkholderia sp. CCGE1002

Annotation: NCBI__GCF_000092885.1:WP_013093230.1

Length: 596 amino acids

Source: GCF_000092885.1 in NCBI

Candidate for 28 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-cellobiose catabolism ptsG hi PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 59% 100% 562.8 PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- 47% 465.3
D-glucose catabolism ptsG hi PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 59% 100% 562.8 PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- 47% 465.3
lactose catabolism ptsG hi PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 59% 100% 562.8 PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- 47% 465.3
D-maltose catabolism ptsG hi PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 59% 100% 562.8 PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- 47% 465.3
sucrose catabolism ptsG hi PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 59% 100% 562.8 PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- 47% 465.3
trehalose catabolism ptsG hi PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 (characterized) 59% 100% 562.8 PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- 47% 465.3
D-cellobiose catabolism ptsG-crr med PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 47% 78% 465.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucose catabolism ptsG-crr med PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 47% 78% 465.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
lactose catabolism ptsG-crr med PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 47% 78% 465.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-maltose catabolism ptsG-crr med PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 47% 78% 465.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
sucrose catabolism ptsG-crr med PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 47% 78% 465.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
trehalose catabolism ptsG-crr med PTS system glucoside-specific EIICBA component; EIICBA-Glc 2; EC 2.7.1.- (characterized) 47% 78% 465.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
N-acetyl-D-glucosamine catabolism nagEIIA med PTS system glucose-specific EIICBA component; EC 2.7.1.-; EC 2.7.1.69 (characterized) 50% 74% 464.9 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucosamine (chitosamine) catabolism nagEIIA med PTS system glucose-specific EIICBA component; EC 2.7.1.-; EC 2.7.1.69 (characterized) 50% 74% 464.9 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-maltose catabolism malEIIA med PTS system glucose-specific EIICBA component; EC 2.7.1.-; EC 2.7.1.69 (characterized) 50% 74% 464.9 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
trehalose catabolism treEIIA med PTS system glucose-specific EIICBA component; EC 2.7.1.-; EC 2.7.1.69 (characterized) 50% 74% 464.9 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucosamine (chitosamine) catabolism gamP med Putative PTS system glucosamine-specific EIICBA component; EC 2.7.1.193 (characterized) 50% 76% 455.7 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
N-acetyl-D-glucosamine catabolism nagEcb med N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized) 44% 96% 454.5 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucosamine (chitosamine) catabolism nagEcb med N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized) 44% 96% 454.5 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
N-acetyl-D-glucosamine catabolism nagEcba med protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized) 42% 76% 384.4 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucosamine (chitosamine) catabolism nagEcba med protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (EC 2.7.1.193) (characterized) 42% 76% 384.4 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
N-acetyl-D-glucosamine catabolism nagPcb med PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized) 44% 99% 376.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucosamine (chitosamine) catabolism nagPcb med PTS system N-acetylglucosamine-specific EIICB component; EIICB-Nag; EC 2.7.1.- (characterized) 44% 99% 376.3 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
N-acetyl-D-glucosamine catabolism ptsC med PTS system N-acetylglucosamine-specific EIIC component; PTS system GlcNAc-specific EIIC component; GlcNAc-specific transporter; N-acetylglucosamine permease IIC component; GlcNAc permease IIC component (characterized) 46% 94% 333.6 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucosamine (chitosamine) catabolism ptsC med PTS system N-acetylglucosamine-specific EIIC component; PTS system GlcNAc-specific EIIC component; GlcNAc-specific transporter; N-acetylglucosamine permease IIC component; GlcNAc permease IIC component (characterized) 46% 94% 333.6 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-maltose catabolism malEIICBA lo PTS system, IIABC components (characterized, see rationale) 33% 78% 259.2 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
N-acetyl-D-glucosamine catabolism ptsB lo PTS system N-acetylglucosamine-specific EIIB component; PTS system GlcNAc-specific EIIB component; N-acetylglucosamine-specific phosphotransferase enzyme IIB component; GlcNAc-specific phosphotransferase enzyme IIB component; EC 2.7.1.193 (characterized) 40% 99% 67 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8
D-glucosamine (chitosamine) catabolism ptsB lo PTS system N-acetylglucosamine-specific EIIB component; PTS system GlcNAc-specific EIIB component; N-acetylglucosamine-specific phosphotransferase enzyme IIB component; GlcNAc-specific phosphotransferase enzyme IIB component; EC 2.7.1.193 (characterized) 40% 99% 67 PTS system glucose-specific EIICB component; EIICB-Glc; EII-Glc; EC 2.7.1.199 59% 562.8

Sequence Analysis Tools

View WP_013093230.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MFSHAFGVLQKIGKSLMLPVAVLPVAGLLLGLGATDFHGYVPIVVLALMKNAGDVIFANL
PLIFAIGVALGFTENDGVSGIAATIGYLVMTATLGVIAKIEGIETDTIMGIPSIQTGVFG
GILAGGLAAWMFNRYYRITLPPYLGFFAGKRFVPIVTAIGSIVLGAILSFVWPPIGSAIK
AFSHWAAVSDPRTAATVYGFVERLLIPFGLHHIWNVPFFFEMGSFVDPTTGKEVHGDITR
YFAGDPTAGILAGAFLFKMFGLPAAAIAIWHCAKPEKKVAVGGMMVSAALTSFLTGITEP
IEFAFLFVAPVLYLIHACLAASAQFVANTLGMRMGFTFSQGGIDFLMFNLIGGKATHAWY
VFILGPIYAVIYYGVFRFVITRFNLKTPGREDDTADTVAVAASGAGGRSRELVLAFGGRS
NITSLDACITRLRISVKDPALVDEHKLKALGAAGVVRVGNGVQAIFGPLSENMKTDMQDY
LKTAGAEADLPAAGAPGVEGAAATAAAPAAVAASAQHSPQETERAEKIRAALGGAANILK
LDALAATRLRVELSDASRIDAAGLKAAGVVATQALKNGALDLIVGLGSGNLAGAMR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory