Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_013093543.1 BC1002_RS29025 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_000092885.1:WP_013093543.1 Length = 289 Score = 180 bits (456), Expect = 4e-50 Identities = 111/274 (40%), Positives = 160/274 (58%), Gaps = 24/274 (8%) Query: 12 DTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMI 71 D L V ++ +FGGL+A+++ S RG+ ++IGPNGAGK+T+FN +TG P G + Sbjct: 10 DMLFDVRRVTRRFGGLVAVDEVSLSVARGECVSVIGPNGAGKSTLFNLLTGIDAPDAGEV 69 Query: 72 TFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKL-MKASGY 130 F + E+L VARTFQ+ R+F L+VL+N+L+ H +L M G+ Sbjct: 70 RFAGEDVTGMAPEQL------AARGVARTFQHGRVFGNLSVLDNVLIGAHARLAMTRRGW 123 Query: 131 TILG--------LIGVGPYKREAAEAIE-----LARFWLEKADLIDRADDPAGDLPYGAQ 177 ++G L +RE A E LARF L+ R D PA L Y + Sbjct: 124 PVVGAFAEVLRALARPASVRREDAALREEVTTLLARFGTR---LLPRIDQPAHSLSYANR 180 Query: 178 RRLEIARAMCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVME 237 RR+EIARA+ P +L LDEP AG+N E+A + L+ ++ + G +ILLIEH + +VM+ Sbjct: 181 RRVEIARALALRPRILLLDEPTAGMNESETAEMLELILQLKHD-GLTILLIEHKLDLVMQ 239 Query: 238 ISDHVVVLEYGQKISDGTPDHVKNDPRVIAAYLG 271 +SD V+VLE G+KI+ G P V++DP VI AYLG Sbjct: 240 LSDRVLVLEDGRKIASGLPAEVRDDPAVIEAYLG 273 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 289 Length adjustment: 26 Effective length of query: 266 Effective length of database: 263 Effective search space: 69958 Effective search space used: 69958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory