Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_013093682.1 BC1002_RS29780 ABC transporter
Query= TCDB::P0A9S7 (255 letters) >NCBI__GCF_000092885.1:WP_013093682.1 Length = 602 Score = 239 bits (611), Expect = 7e-68 Identities = 127/253 (50%), Positives = 164/253 (64%), Gaps = 1/253 (0%) Query: 3 QPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTI 62 + LL V + RFGG+LAV V+ + EIVSLIGPNGAGKTTVFNCLTG +PTGG I Sbjct: 333 ETLLEVRDMQRRFGGVLAVGGVSFVVRSGEIVSLIGPNGAGKTTVFNCLTGVIRPTGGQI 392 Query: 63 LLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTPS 122 + + L G +I G+ RTFQ +RLF MT EN+L +L+T L + LL PS Sbjct: 393 VWCGERLAGGAPHRIVHQGMARTFQGIRLFGHMTAFENVLTGMDHRLRTPLAAELLALPS 452 Query: 123 FRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPAA 182 R ++ WL +GL + +A++L YGDQRRLEIAR + + P +L+LDEPAA Sbjct: 453 ARAEAADHSTEGLRWLAFVGLAGRSGERAADLPYGDQRRLEIARALASSPRLLLLDEPAA 512 Query: 183 GLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQIR 242 G+NP E + L ELI +R+ H T+LLIEHDM LVMG+SDRI V++ G +A G P I+ Sbjct: 513 GMNPTEKRALMELIRRIRD-HGVTVLLIEHDMMLVMGVSDRIIVMDHGVIIAEGPPAAIQ 571 Query: 243 NNPDVIRAYLGEA 255 +P VI AYLG A Sbjct: 572 ADPHVIDAYLGTA 584 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 602 Length adjustment: 30 Effective length of query: 225 Effective length of database: 572 Effective search space: 128700 Effective search space used: 128700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory