Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_013135192.1 ARNIT_RS06935 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH8 (254 letters) >NCBI__GCF_000092245.1:WP_013135192.1 Length = 255 Score = 266 bits (680), Expect = 3e-76 Identities = 129/249 (51%), Positives = 176/249 (70%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 +LEV +TK+FGG+TA+ D + ++ E+ GLIGPNGAGKTT+FN++TG YEP+ G + Sbjct: 2 ILEVCNVTKNFGGVTAIKDTSFQVKAKEIYGLIGPNGAGKTTMFNIITGNYEPTHGDIKF 61 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 G +NG PYKI G+ RTFQNIRLF +TVLDNVLI F F + RLP F+ Sbjct: 62 HGQKINGIKPYKIVHRGIARTFQNIRLFNSMTVLDNVLIGFDYQASYSYFETIFRLPRFF 121 Query: 123 KSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAGM 182 K EK +K +A E++++ + A+ LA +LSYG QR++EI RALA P++L LDEPAAGM Sbjct: 122 KEEKRVKQRAFEIMEVLGIAQYADELATSLSYGSQRKVEIARALAANPQLLLLDEPAAGM 181 Query: 183 NPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKTN 242 NPQET EL EL +I+D+F ITI+LIEHDM V + +R+ VL+YG+ I +G ++ + Sbjct: 182 NPQETHELAELFFKIRDQFDITILLIEHDMKFVNHLCDRVMVLDYGKTIFEGKIEDAIKD 241 Query: 243 KRVIEAYLG 251 + VI+AYLG Sbjct: 242 EEVIKAYLG 250 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 255 Length adjustment: 24 Effective length of query: 230 Effective length of database: 231 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory