Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_013135595.1 ARNIT_RS08945 ABC transporter ATP-binding protein
Query= TCDB::Q8DQH7 (236 letters) >NCBI__GCF_000092245.1:WP_013135595.1 Length = 240 Score = 241 bits (615), Expect = 9e-69 Identities = 129/233 (55%), Positives = 166/233 (71%), Gaps = 2/233 (0%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEF 62 +L+V +L V YG I A++ ++ V GEVV+++GANGAGKTT LRT+SGL++P SG I F Sbjct: 7 LLEVRDLHVSYGAISAIKGINLTVLRGEVVTILGANGAGKTTTLRTISGLLKPKSGNIIF 66 Query: 63 LGQEIQKMPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAFLKKNREENQANLKKVFSR 122 +I K A IV G+S PEGR VF LTV ENL MGA+ K ++ L ++ Sbjct: 67 DKNDITKSEAHDIVTLGMSHSPEGRRVFGTLTVEENLMMGAYTLKGYDKE--TLDWIYDI 124 Query: 123 FPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDIIQDI 182 PRL+ERK Q A TLSGGEQQMLA+GRA+MS PKLL+LDEPS+GLAPI I+ IF I++I Sbjct: 125 LPRLKERKKQLAGTLSGGEQQMLAIGRAIMSKPKLLILDEPSLGLAPILIKAIFKAIKEI 184 Query: 183 QKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 G TVLL+EQNA AL ++DR YVLE GKI GT +EL +S+ +++AYLG Sbjct: 185 ALNGVTVLLVEQNAKAALKLADRAYVLEVGKITHEGTAEELLNSKTIQEAYLG 237 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 240 Length adjustment: 23 Effective length of query: 213 Effective length of database: 217 Effective search space: 46221 Effective search space used: 46221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory