Align Leucine ABC transporter subunit substrate-binding protein LivK (characterized, see rationale)
to candidate WP_013135599.1 ARNIT_RS08965 branched-chain amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A160A0J6 (375 letters) >NCBI__GCF_000092245.1:WP_013135599.1 Length = 373 Score = 159 bits (402), Expect = 1e-43 Identities = 107/362 (29%), Positives = 186/362 (51%), Gaps = 8/362 (2%) Query: 7 QISKLFAAMVL-AGVASHSFAADTIKIGIAGPKTGPVAQYGDMQFSGSKMAIEQINAKGG 65 +++K+ +A+ L A V++ FAADT+KIG+ P TG A G + ++ ++ NA+GG Sbjct: 2 KLTKIASALALSAAVSTILFAADTVKIGVQAPITGQYANEGQSIENFVRLIADEKNAEGG 61 Query: 66 VNGKQLVAVEYDDACDPKQAVAVANKVVNDGIKFVVGHLCSSSTQPASDIYEDEGVVMIT 125 + GKQ+ + DD ++A A K+ N G+ V+G S +T+ A Y + V+ T Sbjct: 62 LLGKQIEVITCDDEAKAQKAAVCAKKLTNAGVIAVIGSYTSGATEAAQTTYYRKKVLQ-T 120 Query: 126 PAATSPDITARGYKMIFRTIGLDSAQGPAAGNYIADHVKPKIVAVLHDKQQYGEGIASAV 185 TS + A+ Y FR +SAQ +Y+ K K + VL D Y EG+ A Sbjct: 121 SDGTSDSLIAKKYWTFFRNSFPNSAQSDFTADYMVKIKKYKKIVVLSDYSSYSEGLGDAT 180 Query: 186 KKTLEDKGVKVAVFEGVNAGDKDFSSMIAKLKQANVDFVYYGGYHPELGLILRQSQEKGL 245 + +++ G V + +G ++FS+++ K+K+ D +YY GY+ + GL+ Q ++ + Sbjct: 181 EASIKALGGNVIYRGKIKSGTQNFSAILTKIKEMKPDVIYYSGYYTDGGLLRAQQKQLQI 240 Query: 246 KAKFMGPEGVGNDSISQIAKESSEGLLV---TLPKSFDQDPANIALADAFKAK-KEDPSG 301 A F+G + N ++A +++ G ++ P+ A LA A+KA+ K DP Sbjct: 241 DADFVGGDSNDNPDFYKLAGKAAAGTILINFPTPEILPYPEAKKYLA-AYKARFKMDPPS 299 Query: 302 PFVFPSYSAVTVIADAIKAAKSEDAGKVAEAIHA-GTFKTPTGDLSFDKNGDLKDFKFVV 360 + + I + ++ KS D K+AE I + F TG + ++G+ KFVV Sbjct: 300 IWPVTNADGFRAIIEGVEKTKSFDTKKIAEYIRSMKDFPGITGPFNIREDGERVGAKFVV 359 Query: 361 YE 362 Y+ Sbjct: 360 YK 361 Lambda K H 0.314 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 373 Length adjustment: 30 Effective length of query: 345 Effective length of database: 343 Effective search space: 118335 Effective search space used: 118335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory