Align L-lactate dehydrogenase (EC 1.1.1.27) (characterized)
to candidate WP_013135721.1 ARNIT_RS09570 malate dehydrogenase
Query= BRENDA::Q27797 (326 letters) >NCBI__GCF_000092245.1:WP_013135721.1 Length = 315 Score = 236 bits (601), Expect = 7e-67 Identities = 130/317 (41%), Positives = 192/317 (60%), Gaps = 11/317 (3%) Query: 7 RRKKIAMIGSGMIGGTMGYLCVLRELAD-VVLFDVVTGMPEGKALDDSQATSIADTNVSV 65 + KK+ +IG G +G T+ Y + + +VL D+ + + ALD SQA + A ++ V Sbjct: 2 KNKKVGIIGVGNVGSTLAYTLASKGICGKIVLKDIRENIVKAMALDISQAANAASSSTLV 61 Query: 66 TSANQYEKIAGSDVVIITAGLTKVPGKSDKEWSRNDLLPFNAKIIREVAQGVKKYCPLAF 125 ++A + DV++ITAG+ + PG S R+DLL NAKI++ V + +++ P A Sbjct: 62 SAAKDSNDLKDCDVIVITAGIPRKPGMS-----RDDLLLTNAKIMKIVVKDIEEQAPNAI 116 Query: 126 VIVVTNPLDCMVKCFHEASGLPKNMVCGMANVLDSARFRRFIADQLEISPRDIQATVIGT 185 +IVV+NPLD MV + S KN + GMA +LDSAR FI ++L I A+V+G Sbjct: 117 IIVVSNPLDVMVYTALKVSNFSKNQIIGMAGILDSARMSHFILEKLGYGAGQINASVMGG 176 Query: 186 HGDHMLPLARYVTVSGFPLREFIKKGKMTEAKLAEIVERTKKAGGEIVRLLGQGSAYYAP 245 HGD M+PL + TV+G L E + + + +IVE+TK G +IV+ L +GSAYYAP Sbjct: 177 HGDDMVPLPNFSTVAGVHLSEVL-----SSQDIEDIVEKTKNGGAQIVKYLERGSAYYAP 231 Query: 246 ALSAITMAQAFLKDEKRVLPCSVYCQGEYGLHDMFIGLPAVIGGGGIEQVIELELTHEEQ 305 A S M +A L D+K V PC+V GEYG D+ G+P ++G G+E++IEL LT E++ Sbjct: 232 AYSTSLMVEAILHDKKEVYPCAVLLDGEYGYKDIVSGVPIMLGKNGVEKIIELNLTDEQK 291 Query: 306 ECFRKSVDDVVELNKSL 322 E F+KSV V EL +L Sbjct: 292 ELFKKSVTSVKELVDTL 308 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 315 Length adjustment: 28 Effective length of query: 298 Effective length of database: 287 Effective search space: 85526 Effective search space used: 85526 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory