Align aconitate DELTA-isomerase (EC 5.3.3.7) (characterized)
to candidate WP_013136523.1 ARNIT_RS13725 2-methylaconitate cis-trans isomerase PrpF
Query= BRENDA::Q8EJW4 (397 letters) >NCBI__GCF_000092245.1:WP_013136523.1 Length = 392 Score = 509 bits (1312), Expect = e-149 Identities = 249/390 (63%), Positives = 310/390 (79%), Gaps = 6/390 (1%) Query: 6 FPPQIKVAATYMRGGTSKGVFFRLQDLPEAAQVPGPARDALLLRVIGSPDPYAKQIDGMG 65 + PQ KV ATYMRGGTSKG FF + DLP+ AQ A++ LL R++GSPD Y KQIDGMG Sbjct: 3 YQPQFKVRATYMRGGTSKGTFFNITDLPKEAQENQEAKNRLLQRIVGSPDAYKKQIDGMG 62 Query: 66 GATSSTSKTVILSHSSKANHDVDYLFGQVSIDKPFVDWSGNCGNLTAAVGAFAISNGLID 125 GATSSTSKTV++ S NHDVDY FGQV+IDK F+DWSGNCGNL++AVG FAI GL+D Sbjct: 63 GATSSTSKTVLVGKSEVPNHDVDYYFGQVAIDKDFMDWSGNCGNLSSAVGPFAIKEGLVD 122 Query: 126 AARIPRNGVCTVRIWQANIGKTIIAHVPITDGAVQETGDFELDGVTFPAAEVQIEFMNPA 185 +P++GVC V+IWQANI KTI+ +V + DG V+E GD+E+DGVTFPA E+++EF+ P Sbjct: 123 --NVPQDGVCCVKIWQANIKKTILCYVTMADGMVKEIGDYEIDGVTFPAEEIKLEFVEPV 180 Query: 186 ADDDGEGGCMFPTGNLVDVLEVPGIGRFNATMINAGIPTIFINAEDLGYTGTELQDDINS 245 + +FPTGNLVD LEVPG+G F ATMI AGIPTIF+NA+++GYTGTELQ DINS Sbjct: 181 DPSEE----LFPTGNLVDDLEVPGVGTFKATMITAGIPTIFLNADEIGYTGTELQGDINS 236 Query: 246 DNAALAKFETIRAHGALRMGLIKHIDEAASRQHTPKIAFVAPPKSYASSSGKTVAAEDVD 305 D AL +FETIR GA++MGL+K +A ++QH PK+AFVAPP + +S+GKT+ A ++D Sbjct: 237 DVEALKRFETIRIAGAMKMGLMKDAKDAETQQHVPKVAFVAPPSDFTTSTGKTIKANELD 296 Query: 306 LLVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLAAGGGEKEAVRFGHPSGTLRVGAQ 365 L VRALSM +LHHAMMGTA+VAIG AA +PGTLVNLAAGGG+K+AV FGHPSGTL+VGA Sbjct: 297 LHVRALSMQQLHHAMMGTASVAIGVAACVPGTLVNLAAGGGQKDAVNFGHPSGTLKVGAS 356 Query: 366 AVQENGEWTVIKAIMSRSARVLMEGFVRVP 395 ++G++ V KA MSRSAR++MEG V VP Sbjct: 357 LTNKDGKYKVEKASMSRSARIIMEGNVYVP 386 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 392 Length adjustment: 31 Effective length of query: 366 Effective length of database: 361 Effective search space: 132126 Effective search space used: 132126 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory