Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_013258113.1 DEBA_RS06445 enoyl-CoA hydratase
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_000143965.1:WP_013258113.1 Length = 262 Score = 138 bits (348), Expect = 1e-37 Identities = 86/254 (33%), Positives = 137/254 (53%), Gaps = 1/254 (0%) Query: 1 MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAG 60 +++ E + + V+T+NRP+ LNA++ +++D L A + D +RA ++TGAGRAF AG Sbjct: 5 VIIFETEGPLAVVTVNRPKALNALSPQVMDELTDAFDKISTDENIRAAVITGAGRAFVAG 64 Query: 61 QDLTEFGDRKP-DYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAA 119 D++ P ++ +++ E + KP++ AVNG G G LA+ D A+ Sbjct: 65 ADISAMQTYTPLQARGFAKKGHKLGEKIENCPKPVIAAVNGFCLGGGCELAMCCDFIYAS 124 Query: 120 VGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPA 179 GA F + +G+VP G + LPRLVG A+ L + + A+EA A+GLV RV P Sbjct: 125 EGAKFGQPEINLGIVPGFGGTQRLPRLVGKGWAKLLCMTGEMIGAQEAAAIGLVTRVFPE 184 Query: 180 EKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEG 239 +++E A A + + K+L+ + + L L AL LEA + + D EG Sbjct: 185 GEVLEAAKKTALLMCGKGMVSLRAAKQLVEQGFDLPLQRALDLEAEVFCTCFTSPDQREG 244 Query: 240 VRAFREKRPPRFQG 253 + AF EKR F+G Sbjct: 245 MSAFLEKRKADFKG 258 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 262 Length adjustment: 24 Effective length of query: 230 Effective length of database: 238 Effective search space: 54740 Effective search space used: 54740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory