Align acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate WP_013258114.1 DEBA_RS06450 acetyl-CoA C-acetyltransferase
Query= BRENDA::P45359 (392 letters) >NCBI__GCF_000143965.1:WP_013258114.1 Length = 392 Score = 493 bits (1268), Expect = e-144 Identities = 249/392 (63%), Positives = 308/392 (78%), Gaps = 1/392 (0%) Query: 1 MKEVVIASAVRTAIGSYGKSLKDVPAVDLGATAIKEAVKKAGIKPEDVNEVILGNVLQAG 60 MKEVVIA A RTA+G +G D+ AV LG TA KEA+ +AG+ V+E+I GNVL AG Sbjct: 1 MKEVVIAGAARTAVGRFGGMYSDISAVQLGVTAAKEALARAGVGVAMVDELIFGNVLGAG 60 Query: 61 LGQNPARQASFKAGLPVEIPAMTINKVCGSGLRTVSLAAQIIKAGDADVIIAGGMENMSR 120 LGQN ARQ AG+PV+ A T+NKVC SGL++V LAAQ + DA++++AGG ENMS+ Sbjct: 61 LGQNVARQVQIGAGVPVDKNAFTVNKVCASGLKSVMLAAQAVMCDDAEIVVAGGTENMSQ 120 Query: 121 APYLANNARWGYRMGNAKFVDEMITDGLWDAFNDYHMGITAENIAERWNISREEQDEFAL 180 APYL R+GYRMGN +D MI DGLWD FN YHMGITAEN+AE++ ++R+ QD+ A Sbjct: 121 APYLMPKGRFGYRMGNGSLIDSMINDGLWDIFNGYHMGITAENVAEKYGLTRQAQDQLAC 180 Query: 181 ASQKKAEEAIKSGQFKDEIVPVVIKGRKGE-TVVDTDEHPRFGSTIEGLAKLKPAFKKDG 239 ASQ +A+ AI +G+FKDEIVPV+ RKGE +DTDE PRF +TI+ LAKLKPAFKKDG Sbjct: 181 ASQNRAQAAITAGRFKDEIVPVMAPQRKGEPKALDTDEFPRFDTTIDDLAKLKPAFKKDG 240 Query: 240 TVTAGNASGLNDCAAVLVIMSAEKAKELGVKPLAKIVSYGSAGVDPAIMGYGPFYATKAA 299 TVTAGNASG+ND AA +V+ S EKA LG+ LAKI SYG GVDP++MG GP A+K+A Sbjct: 241 TVTAGNASGINDGAAAVVVTSREKANALGLPILAKIKSYGWGGVDPSVMGLGPIEASKSA 300 Query: 300 IEKAGWTVDELDLIESNEAFAAQSLAVAKDLKFDMNKVNVNGGAIALGHPIGASGARILV 359 + KAG TV++LDLIE+NEAFAAQ+LAV +LKF+ + VNVNGGAIALGHPIGASGARILV Sbjct: 301 LTKAGLTVEDLDLIEANEAFAAQALAVIGELKFNTDIVNVNGGAIALGHPIGASGARILV 360 Query: 360 TLVHAMQKRDAKKGLATLCIGGGQGTAILLEK 391 +L++ M +RDAK GLATLCIGGGQG A++LE+ Sbjct: 361 SLIYEMLRRDAKLGLATLCIGGGQGAAMILER 392 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 392 Length adjustment: 31 Effective length of query: 361 Effective length of database: 361 Effective search space: 130321 Effective search space used: 130321 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_013258114.1 DEBA_RS06450 (acetyl-CoA C-acetyltransferase)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.31223.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-145 468.6 7.1 8.6e-145 468.4 7.1 1.0 1 lcl|NCBI__GCF_000143965.1:WP_013258114.1 DEBA_RS06450 acetyl-CoA C-acetyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000143965.1:WP_013258114.1 DEBA_RS06450 acetyl-CoA C-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.4 7.1 8.6e-145 8.6e-145 1 385 [] 6 391 .. 6 391 .. 0.99 Alignments for each domain: == domain 1 score: 468.4 bits; conditional E-value: 8.6e-145 TIGR01930 1 ivdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaag 69 i +a+Rt++g++gg ++++sa++L++++ ke+l+rag+ + +de+i+Gnvl ag ++n+aR++ + ag lcl|NCBI__GCF_000143965.1:WP_013258114.1 6 IAGAARTAVGRFGGMYSDISAVQLGVTAAKEALARAGVGVAMVDELIFGNVLGAGLGQNVARQVQIGAG 74 7899***************************************************************** PP TIGR01930 70 lpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakled 138 +p + +a+tvn+vCaSgl++v+laaq++++ +a++vvaGG E+mS++p+l+++ r ++++g+ +l d lcl|NCBI__GCF_000143965.1:WP_013258114.1 75 VPVDKNAFTVNKVCASGLKSVMLAAQAVMCDDAEIVVAGGTENMSQAPYLMPKG--RFGYRMGNGSLID 141 ****************************************************97..89*********** PP TIGR01930 139 qllkdl...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk... 201 ++++d+ ++++mg+tAen+a+kyg++R+ qD++a +S+++a++Ai +g+fkdeivpv +++ lcl|NCBI__GCF_000143965.1:WP_013258114.1 142 SMINDGlwdIFNGYHMGITAENVAEKYGLTRQAQDQLACASQNRAQAAITAGRFKDEIVPVMAPQRkge 210 *********99***************************************************9999999 PP TIGR01930 202 kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplariv 270 +k +++De +r +tt+++LakLkpafk+ +g tvtAgN+s++nDGAaa++++s+e+a++lgl +la+i lcl|NCBI__GCF_000143965.1:WP_013258114.1 211 PKALDTDEFPRFDTTIDDLAKLKPAFKK-DG-TVTAGNASGINDGAAAVVVTSREKANALGLPILAKIK 277 9*************************95.9*.6************************************ PP TIGR01930 271 saavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAi 339 s+++ gvdp++mglgp++A++ aL kagl+++d+dl+E nEAFAaq+lav+ el+ +++ vNvnGGAi lcl|NCBI__GCF_000143965.1:WP_013258114.1 278 SYGWGGVDPSVMGLGPIEASKSALTKAGLTVEDLDLIEANEAFAAQALAVIGELK-FNTDIVNVNGGAI 345 *******************************************************.669********** PP TIGR01930 340 AlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 AlGHP+GasGari+++l++e+ +r++k+GlatlC+ggGqGaA+ile lcl|NCBI__GCF_000143965.1:WP_013258114.1 346 ALGHPIGASGARILVSLIYEMLRRDAKLGLATLCIGGGQGAAMILE 391 ********************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (392 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.38 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory