Align short-chain acyl-CoA dehydrogenase monomer (EC 1.3.8.1) (characterized)
to candidate WP_013259251.1 DEBA_RS12245 acyl-CoA dehydrogenase
Query= metacyc::MONOMER-17424 (375 letters) >NCBI__GCF_000143965.1:WP_013259251.1 Length = 384 Score = 316 bits (809), Expect = 8e-91 Identities = 164/378 (43%), Positives = 243/378 (64%), Gaps = 5/378 (1%) Query: 3 VNDEQQQIADAVRAFAQERLKPFAEQWDKDHRFPKEAIDEMAELGLFGMLVPEQWGGSDT 62 + + + + D V F ++ L+P ++Q + + P++ + +M ELGLFG+ +PE++GG + Sbjct: 5 IPENLRMMVDTVAKFVKQDLEPISQQVEDEDHIPEDVVQKMRELGLFGLSIPEEYGGLEL 64 Query: 63 GYVAYAMALEEIAAGDGACSTIMSVHNSVGCVPILRFGNEQQKEQFLTPLATGAMLGAFA 122 G + + EE++ + + + +N +G IL G QQKE++L LA+G FA Sbjct: 65 GTLGECLCYEELSKTNACFRSRIGTNNGIGSQGILLDGTPQQKERYLPNLASGQWTACFA 124 Query: 123 LTEPQAGSDASSLKTRARLEGDHYVLNGSKQFITSGQNAGVVIVFAVTDPEAGKR-GISA 181 LTEP+AGSDA++++T A L+GDH+VLNG K FIT+G A V VFA D + R GI+A Sbjct: 125 LTEPEAGSDAANIQTTAELKGDHWVLNGRKHFITNGDIADVATVFAANDRQKKARGGITA 184 Query: 182 FIVPTDSPGYQVARVEDKLGQHASDTCQIVFDNVQVPVANRLGAE---GEGYKIALANLE 238 FIV PG+ V +E K+G S TC+++FD+ +VP N +G E G+G+K A+ L+ Sbjct: 185 FIVEKTFPGFYVGTIERKMGLRGSHTCELIFDDCRVPRENVIGGETNVGQGFKTAMKTLD 244 Query: 239 GGRIGIASQAVGMARAAFEVARDYANERQSFGKPLIEHQAVAFRLADMATKISVARQMVL 298 GR+ + + A+G A+ +++ YA +R FG+P+ QA+ +LADMAT I ARQM+ Sbjct: 245 KGRLTMGASALGSAQKLMDLSIAYAKQRVQFGQPIANFQAIQIKLADMATHIYAARQMLY 304 Query: 299 HAAALRDAGRPALV-EASMAKLFASEMAEKVCSDALQTLGGYGYLSDFPLERIYRDVRVC 357 HAA LRD A+V EASM KLF +EMA + A+Q GG GY+ DFP+ER YRD+R+ Sbjct: 305 HAAWLRDKRGAAVVKEASMVKLFCTEMANRAADMAVQIHGGMGYVRDFPVERFYRDLRLT 364 Query: 358 QIYEGTSDIQRMVIARNL 375 IYEGTS+IQR VIAR + Sbjct: 365 TIYEGTSEIQRTVIAREI 382 Lambda K H 0.319 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 384 Length adjustment: 30 Effective length of query: 345 Effective length of database: 354 Effective search space: 122130 Effective search space used: 122130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory