Align Beta-ketothiolase BktB; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; EC 2.3.1.16; EC 2.3.1.9 (characterized)
to candidate WP_013417742.1 RVAN_RS00225 acetyl-CoA C-acyltransferase
Query= SwissProt::Q0KBP1 (394 letters) >NCBI__GCF_000166055.1:WP_013417742.1 Length = 399 Score = 305 bits (780), Expect = 2e-87 Identities = 171/402 (42%), Positives = 247/402 (61%), Gaps = 16/402 (3%) Query: 3 REVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQTEP 62 R+ + G+RT IG G+L V P ++ A V+R ALA + DV V+ G Q Sbjct: 2 RDAYIYGGLRTPIGRHAGALAAVRPDDMAAHVIRAALAASPFDAADVEDVILGCACQAGE 61 Query: 63 RDMYLGRVAAVNGGVTINAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESMSR 122 +GR AA+ G+ TVNRLCGSG+ A++ A + + LG ++ + GG ESM+R Sbjct: 62 DARNVGRHAALLAGLPQEVGGATVNRLCGSGMNAVIDAGRAVTLGHAELIVAGGVESMTR 121 Query: 123 APYLA--PAARWGARMGDAGLVDMMLGA------LHDPFHRIHMGVTAENVAKEYDISRA 174 AP++ P A +G D + D +GA L + M TA+N+A + ISRA Sbjct: 122 APFVIAKPQAAYGR---DTAIYDTTIGARFVNARLVATYGNDSMPETADNIAHDLGISRA 178 Query: 175 QQDEAALESHRRASAAIKAGYFKDQIVPVVSKGRKGD-VTFDTDEHVRHDATIDDMTKLR 233 + D AL S + + A+K G+++ +IV V GR+G+ + +DEH R + T + + +L+ Sbjct: 179 EADAFALASQEKTARAVKEGFYEGEIVAVEIPGRRGEAIRVSSDEHPRPETTRETLARLK 238 Query: 234 PVFVKENGTVTAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKAMGIG 293 P+ E G VTAGN+SG+ND AAA+++ R+ E+ G +PLA + + AGV P+ MG+G Sbjct: 239 PL--AEGGIVTAGNSSGINDGAAALLIGSRSAGEKAGAEPLAIVRAAAVAGVPPRIMGVG 296 Query: 294 PVPATKIALERAGLQVSDLDVIEANEAFAAQACAVTKALGLDP--AKVNPNGSGISLGHP 351 PVPA+ ALERAGL ++D+DVIE NEAFA Q + + LDP +++NPNG I+LGHP Sbjct: 297 PVPASAKALERAGLTLADMDVIEINEAFATQVIGCCRLMTLDPSDSRLNPNGGAIALGHP 356 Query: 352 IGATGALITVKALHELNRVQGRYALVTMCIGGGQGIAAIFER 393 +GA+GA + + A +L R GRYALVTMCIG GQGIAA+ ER Sbjct: 357 LGASGARLMLTAARQLQRSGGRYALVTMCIGVGQGIAAVLER 398 Lambda K H 0.318 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 399 Length adjustment: 31 Effective length of query: 363 Effective length of database: 368 Effective search space: 133584 Effective search space used: 133584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory