Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate WP_013418384.1 RVAN_RS03505 acyl-CoA dehydrogenase
Query= BRENDA::Q96329 (436 letters) >NCBI__GCF_000166055.1:WP_013418384.1 Length = 393 Score = 229 bits (584), Expect = 1e-64 Identities = 135/384 (35%), Positives = 208/384 (54%), Gaps = 2/384 (0%) Query: 47 DYYHFNDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI- 105 D + +D L+ EE+ I R ++ + P + + + F I ++G +G+ G +I Sbjct: 8 DPFLLDDQLSEEERLIADSARAYCQERLQPRVLSAYREERFDREILTEMGELGLLGPTIP 67 Query: 106 KGYGCPGLSITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQ 165 + +G G+S A + E+ RVD+ + + V SSL M I G++AQK+++LP LA+ Sbjct: 68 EEFGGAGVSHVAYGLIAREVERVDSGYRSAMSVQSSLVMHPIHAYGTDAQKKRWLPGLAR 127 Query: 166 LNTVACWALTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTTN 225 V C+ LTEPD+GSD + + T A KV+GG+ ++GQK WI NS AD+ +++A++ + Sbjct: 128 GEIVGCFGLTEPDSGSDPASMRTRAVKVDGGYLLSGQKMWITNSPIADIAVVWAKSDAHD 187 Query: 226 -QINGFIVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTSKVL 284 +I GF+V++ G KI K+ LR G+I+L FVP+E+ LPG + L Sbjct: 188 GKIKGFVVERGTKGFSTPKIEGKLSLRASITGEIVLDEAFVPEENLLPGASGLAGPFGCL 247 Query: 285 AVSRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMG 344 +R +AW G + + Y RKQFG PLAA QL Q KL M + Sbjct: 248 NKARYGIAWGVTGAAEFCWHAARDYTLARKQFGRPLAANQLVQFKLAGMQTEIALALQAA 307 Query: 345 WRLCKLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPI 404 R+ ++ + G P SL K KA + A R++ GGNGI F V + +LE + Sbjct: 308 LRVGRMLDEGTAAPEAISLIKRNNCIKALDIARQARDMHGGNGIADSFHVMRHMANLETV 367 Query: 405 YTYEGTYDINTLVTGREVTGIASF 428 TYEGT D++ L+ GR TGI +F Sbjct: 368 NTYEGTQDVHALILGRAQTGIQAF 391 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 393 Length adjustment: 31 Effective length of query: 405 Effective length of database: 362 Effective search space: 146610 Effective search space used: 146610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory