GapMind for catabolism of small carbon sources

 

Protein WP_013419018.1 in Rhodomicrobium vannielii ATCC 17100

Annotation: NCBI__GCF_000166055.1:WP_013419018.1

Length: 358 amino acids

Source: GCF_000166055.1 in NCBI

Candidate for 90 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 96% 238.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
trehalose catabolism thuK med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 96% 238.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 43% 84% 233.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 43% 75% 223 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-cellobiose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-galactose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-glucose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
lactose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-mannose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
sucrose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
trehalose catabolism glcV med monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 41% 80% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-arginine catabolism artP med Arginine transport ATP-binding protein ArtM (characterized) 41% 98% 166 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 99% 229.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 99% 229.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 99% 229.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 99% 229.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 99% 229.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 40% 99% 229.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 38% 85% 228 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 40% 98% 226.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 39% 94% 223.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 39% 94% 223.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 48% 67% 218.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 36% 97% 217.6 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 39% 90% 217.6 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 90% 217.2 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 90% 217.2 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 37% 97% 216.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 39% 94% 216.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 36% 95% 216.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 38% 95% 213.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 36% 95% 213.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 38% 91% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 37% 96% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 37% 96% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 37% 96% 213 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 92% 211.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 39% 85% 211.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 98% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 98% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 98% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 98% 208 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 39% 96% 204.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 37% 99% 204.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 80% 201.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 38% 80% 201.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 38% 91% 200.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 34% 95% 197.6 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 33% 98% 190.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 95% 188.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 95% 188.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 95% 188.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 95% 188.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 95% 188.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 95% 188.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 36% 80% 180.6 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 34% 92% 179.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 33% 85% 177.6 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 89% 166.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 89% 166.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 38% 96% 163.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-glutamate catabolism gltL lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 38% 96% 163.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 38% 93% 162.2 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 91% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 91% 160.2 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 35% 99% 154.1 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 35% 99% 154.1 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-asparagine catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 34% 98% 153.3 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-aspartate catabolism aatP lo Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) 34% 98% 153.3 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 36% 93% 153.3 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 152.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 91% 152.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 37% 93% 152.1 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-histidine catabolism BPHYT_RS24015 lo ABC transporter related (characterized, see rationale) 39% 90% 152.1 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 95% 151.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-lysine catabolism hisP lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 36% 95% 151.4 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-histidine catabolism hisP lo Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 34% 96% 150.6 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 93% 148.7 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 30% 87% 145.6 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-citrulline catabolism AO353_03040 lo ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 34% 99% 142.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 35% 91% 139.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 33% 92% 132.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 38% 74% 127.9 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 35% 75% 124.8 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 31% 99% 122.5 CysA aka B2422, component of Sulfate/thiosulfate porter 57% 321.2

Sequence Analysis Tools

View WP_013419018.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKIDVRNLSKRFGNFVALKNVDLDIASGELLALLGPSGSGKTTLLRIIAGLDFADGGEVY
FAGENAANLNVRKRHVGFVFQHYALFRHMTVFENVAFGLRVRPRRERKPEHEIVKRVKRL
LEFVHIEGLAERYPDQLSGGQRQRVALARALAIEPNVLLLDEPFGALDAKVRKSLRRWLR
DLHGELNVTSVLVTHDQEEALEVADRIVVMGNGKIEQVGTPEEIYNEPANSFVFDFIGES
VKLPVRIENGGIWIGSRRLATNDELPASGPARLFVRPHDLTFGEVSEAPLQGAVRSVRRV
GALSFADVRLDYGGDDLLVEASLPPETIVRAGDLVGLTPRRYRIYEDGAAESLTSAAL

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory