Align 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 (characterized)
to candidate WP_013420213.1 RVAN_RS13190 3-isopropylmalate dehydratase small subunit
Query= SwissProt::Q1MA52 (202 letters) >NCBI__GCF_000166055.1:WP_013420213.1 Length = 201 Score = 318 bits (814), Expect = 5e-92 Identities = 149/201 (74%), Positives = 172/201 (85%) Query: 1 MDKFVKLTGVAAPLPVVNVDTDMIIPKDYLKTIKRTGLGTGLFAEARYNEDGSENPDFVL 60 M+KF LT VAAPLP++N+DTDMIIPK +LKTIKRTGLG LF E R++E G+ENPDFVL Sbjct: 1 MEKFTTLTSVAAPLPLINIDTDMIIPKQFLKTIKRTGLGKSLFYEMRFDEQGNENPDFVL 60 Query: 61 NKPAYRDAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFYNNCFKNGILPIK 120 NKPAYR +KILVAGDNFGCGSSREHAPWALLDFG+RCVISTSFADIFYNNCFKNGILPI Sbjct: 61 NKPAYRASKILVAGDNFGCGSSREHAPWALLDFGVRCVISTSFADIFYNNCFKNGILPIT 120 Query: 121 VSQEDLDKLMDDASRGSNAILTVDLENLEITGPDGGLIKFDLDEFKRHCLLNGLDDIGLT 180 VS EDL KLMDDA RGSNA LTVDLE EI GPDGG+++FD+D F++ CL+ GLDDIGLT Sbjct: 121 VSPEDLAKLMDDAERGSNATLTVDLEAQEIRGPDGGVVRFDIDPFRKKCLIEGLDDIGLT 180 Query: 181 LEKGKAIDSFEKKNAASHPWA 201 ++K +I+ +E + S PWA Sbjct: 181 MQKADSIELYETTSQLSRPWA 201 Lambda K H 0.319 0.140 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 202 Length of database: 201 Length adjustment: 21 Effective length of query: 181 Effective length of database: 180 Effective search space: 32580 Effective search space used: 32580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_013420213.1 RVAN_RS13190 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.2741.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.2741.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.