Protein WP_013421089.1 in Rhodomicrobium vannielii ATCC 17100
Annotation: NCBI__GCF_000166055.1:WP_013421089.1
Length: 278 amino acids
Source: GCF_000166055.1 in NCBI
Candidate for 22 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 71% | 172.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 71% | 172.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 44% | 62% | 170.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 44% | 62% | 170.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 44% | 62% | 170.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 44% | 62% | 170.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 44% | 62% | 170.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 44% | 62% | 170.6 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
putrescine catabolism | potA | lo | PotG aka B0855, component of Putrescine porter (characterized) | 44% | 56% | 169.9 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 43% | 58% | 161 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 42% | 56% | 160.2 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 40% | 62% | 157.5 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-maltose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 40% | 69% | 157.1 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-mannose catabolism | TT_C0211 | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 40% | 69% | 157.1 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
trehalose catabolism | thuK | lo | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 40% | 69% | 157.1 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 40% | 64% | 157.1 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 38% | 65% | 156 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-sorbitol (glucitol) catabolism | mtlK | lo | ABC transporter for D-Sorbitol, ATPase component (characterized) | 40% | 62% | 155.2 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-maltose catabolism | malK | lo | Maltose-transporting ATPase (EC 3.6.3.19) (characterized) | 39% | 65% | 154.8 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-maltose catabolism | musK | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 38% | 66% | 152.9 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
L-fucose catabolism | SM_b21106 | lo | ABC transporter for L-Fucose, ATPase component (characterized) | 41% | 61% | 151.8 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 40% | 60% | 150.2 | Aliphatic sulfonates import ATP-binding protein SsuB; EC 7.6.2.- | 46% | 215.3 |
Sequence Analysis Tools
View WP_013421089.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MTALANPVTFRLAALELESVGRAFDVAGTKFDALRDVSLTVCEGEFIAFVGASGCGKSTL
LKAIVGLDRGFEGSIRIDGKPVDGPNLDRSIVFQEHRLLPWLTVEANVGAALRRSGLPSS
ERKQRVAEQLDLVGLSSFAKAYPAQLSGGMAQRVAIARALVTRPRFLLLDEPLGALDALT
RLRLQGELARLIRHEGTTALLVTHDVDEAVTLADRIVVMKPHPGRVARILDVPRHAIRDR
SSPAFLRARDEVLGLLGVPGFVEEPDAPRDRPAELQTA
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory