Align UDP-glucose 4-epimerase; UDP-galactose 4-epimerase; Uridine diphosphate galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_013421188.1 RVAN_RS18385 NAD-dependent epimerase/dehydratase family protein
Query= SwissProt::A0R5C5 (313 letters) >NCBI__GCF_000166055.1:WP_013421188.1 Length = 318 Score = 154 bits (390), Expect = 2e-42 Identities = 103/314 (32%), Positives = 148/314 (47%), Gaps = 15/314 (4%) Query: 2 RTLVTGAAGFIGSTLVDRLLADGHGVVGLDDLSSGRAENLHSAENSDKFEFVKADIVDAD 61 R LVTG AGF+GS L+DRLLADGH V+ +D+L +G N+ +FEF++ D+ Sbjct: 10 RVLVTGGAGFLGSHLIDRLLADGHEVLCVDNLFTGTKRNIDHLHGQPRFEFMRHDVT--- 66 Query: 62 LTGLLAEFKPEVIFHLAAQISVKRSVDDPPFDATVNVVGTVRLAEAARLAGVRKVVHTSS 121 L + + I++LA S DP +V G + + A+ R + +S Sbjct: 67 ---LPLYVEVDEIYNLACPASPVHYQHDPVQTTKTSVHGAINMLGLAKRLKCR--ILQAS 121 Query: 122 GGSVYGTPPAYPTSEDM-----PVNPASPYAAGKVAGEVYLNMYRNLYDLDCSHIAPANV 176 VYG P +P ED P+ P S Y GK E Y + LD N Sbjct: 122 TSEVYGDPAVHPQREDYWGNVNPIGPRSCYDEGKRCAETLFFDYNRQHQLDIKVARIFNT 181 Query: 177 YGPRQDPHGEAGVVAIFSEALLAGRTTKIFGDGSDTRDYVFVDDVVDAFVR-AGGPAGGG 235 YGPR + VV+ F L ++GDG TR + +VDD++D VR PAG Sbjct: 182 YGPRMH-RADGRVVSNFIVQALTNEPITLYGDGRQTRSFCYVDDLIDGLVRLMNSPAGFI 240 Query: 236 QRFNVGTGVETSTRELHTAIAGAVGAPDEPEFHPPRLGDLRRSRLDNTRAREVLGWQPQV 295 N+G E S EL + + E + P D ++ + D A+ LGWQP+V Sbjct: 241 GPVNLGNPGEFSMLELAREVVRQTDSASEIVYRPLPADDPKQRQPDIALAQAKLGWQPEV 300 Query: 296 ALAEGIAKTVEFFR 309 L+EG+ T+ +FR Sbjct: 301 PLSEGLKPTIAYFR 314 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 318 Length adjustment: 27 Effective length of query: 286 Effective length of database: 291 Effective search space: 83226 Effective search space used: 83226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory